Wiccan Bible: Exploring the Mysteries of the Craft From Birth to Summerland - Drew A.J. A 2003
Preface
(Otherwise Known as My Last Ritual)

am a creature of habit. I find things in this world that I like, and I do those things again and again because they make me feel good. These regular rituals are usually simple things. I meditate with my iguana on my lap or let my ferret run around my bedroom, her little butt running faster than her front
am a creature of habit. I find things in this world that I lik things again and again because they make me feel good. The are usually simple things. I meditate with my iguana on ferret run around my bedroom, her little butt running fast end until she trips over herself again and again. At night, I w Factor at 11 p.m. with my mother, and in the morning I Mountain Dew on my way to work.
In the course of writing this book, almost all of this has changed ferret died within days of each other, despite every effort to save them heart had been ripped from my chest. I had fed my iguana Fred so Chili, and the next morning she was horribly ill. Then I fed a grape to thinking that grapes from a grocery store could be poison. Shortly the ill. In my attempts to save them, each of these friends took their final b of being stuck with needles and IVs. So not only did I kill them, but in m
eat nati
pit
5
despite opinions on the war itself, folks would realize combatants do not determine
8 A Wiccan Bible
Commander In Chief without respect to political Artwsoi: InaBingse
I was wrong. In trying to extend the lives of Fred and Thumper, I extended their despite opinions on the war itself, folks would realize combatants d politics, and that in the United States military our soldiers follow t Commander In Chief without respect to political parties or leanings.
I was wrong. In trying to extend the lives of Fred and Thumper, suffering. In assuring my mother that Americans would all rally and s their soldiers, I set her up for a fall. Now there is no more Fred to med is no more Thumper to run around and make me laugh, and there is n at 11 p.m.; he has been pre-empted for reports on the war. We all ma those mistakes are part of the people that we are. We make mistake them, and we move forward. We manage this because we cling to th life. Even when we might not see those good things in the moment, w are just right around the corner. I can deal with this because I still h Mountain Dew.
But it isn’t just soda that starts my day; it is the smiling face of the sells me that soda. It is all part of the ritual. We never really talk mu begin to see the nature of someone’s soul, even from the smallest of day after I asked her how she was, she told me she was in pain because foot was broken. She laughed as she told me she called her father and still broken when she got off work, that he would take her to the ho morning I asked her if her foot was still ’broken’ and she said no. I t minds me of whfahwaoyoung, b efore dbecame as ja de dnow ”m. It is a good thing because if you helievein magick.thenyoiiknow thatthss mosningriCnalmaukedmf younger and lessjadad.lt rnmindsmotbat three Isdo-cand thadsoma childeendo continue to love thktkparents,evaalhobg—itsomalimesseams stil’nen—ka
Recently, she asked me whatldofoa alosug .Harm se°tos;ig .So whad wae arigi-oecaiae tf iti oelteye td sadtck, aied iti kdtw aiaa aita strdtdd rt iaisder asd leaa taded. ea restsda se aiaa aiere ta iape asd aiaa a oasatsie aa laye aietr paresaa, eyes aiaidi ta aaseatsea aeesa aa tw s
Reoesali, aie aaked se hiaa e da war a ltytsd. e rewiaed aa aai. aa salli aaked aie hai ase stdia aak “Hah ia datsd” iaa airsed tsaa a d
I were to answer her queatiahan I mhthdgamymhemight misiiiuiersaiisd my andker. sare aias eyer. e seed aie iaiaiwil apatstas. e seed aaseaitsd, asi atere ta tape war atta harik. ea kaead’a aake siota tiaa a oteerwii wao tiaa ade peraad hta aatii iayea ate harik da saaaer tah idis ta aeesa a e here aa adaher ter qieaatad adk edk ate dasea ate stdta staidkera ea ta aa eaas aa staidkeraaadk adk aa tark aa wtdk ate harka ataa appra ss ta.. ataiik e aeii ter htaa e ka war a itytdd?
dangerous and ask ths acdstobiotect tlw community fromthelikesoOmh.Thad, two, has happened.
You see, the status quo doesn’t like people like me. The status quo wants you to
Preface
low the standard operating procedure. Conduct business reusuel. Oh, I am not always right, and sometimes it takes me far to long to admit when I am wrong. But that which
You see, the status quo doesn’t like people like me. The status q just accept what you have been told and not question the world in whi low the standard operating procedure. Conduct business as usual. Oh, right, and sometimes it takes me far to long to admit when I am wrong drives my spirit, the Ka that motivates my Ba, the Yang that rocks my completes my In, and the mind that guides my soul, leaves me with no forth to this world the many things that it has seen and the many que formed.
So what do I do for a living? I am a professional Witch. “Profe such is my love of Witchcraft that I have worked it into not only my p into that which I do to fund that personal life, my work. “Witch” becau world in which I live. Oh, I know some folk have heard stories that Wi the worship of Satan or other boogiemen. Others have been convinced is the oldest religion the world has ever known. But the truth is where it someplace in the middle.
Witchcraft is not the world’s oldest religion by any stretch of the ima one insist that words have specific meaning, then Witchcraft is much t called a religion. While one might say that Witchcraft is a religion, error if they put a period at the end of that definition because it is s would be better to say Witchcraft can be a religion.
Instead, I think of sowhone whnsesnuCgivesonenowltennativnkuf toloveisfetswell as to identify whyitrs shat wellve. AWitchis onewho,indeteeminingwgatis what and sther half asks why there ss thss zest fsr lsfe and why there are all thsng told.
fnttlit,sfsthsnkssfstsvlsnlswhstlstsulsgsvltssnlsnssiltlrnitsvlsbutsts itstssstlntsfyswhysstsststhitswlslsvlisAsWstchsstssnlswhs,ssnstltlrvsnsngs whssstswhs,sillswtshstssrshlrsSisrststsstlcstl,srithlrsthinstsvilysbllsl tslti
ftsWstchcriftsthlswsrthsissfsSitin?sWlll,swhitsstsSitin?sWhlns wsrtssatan,swlstllsthitssttssrsgsnilsvlinsngswitsnsthsngsvsrlsthins’tss itsitvlrtiryi’sWsthsthstsuntlrttintsngssfsthlswsrtssatan,sthlsnlxtsttlis qulttssnsstssbvssut:sWhat is it that you are asking if Witches are aver itksngssfsWstchltsirlsivlrtlstssblsngstsltswhitstssthsnk,sthlnsysusir knswsvysintwlrisChincltsirlsysusirlswrsngisYsustll,swhsllsWstch ivlrtlstssblsngstsltswhitstssthsnkswsthsutsblsngsillswltstssthsnksfsrs tssnstsworshipsthitsivlrtssnisThlsrsSisrstsissthitsivlrtssni
Wstchltsirlsivlrtlstssthlsttintirtssilritsngsirsclturlsthitshitsc tsstlsissntssthlsiliclswhlrlsstsnswsrltttisNstssnlystsltsthlsistlntsilsfs lssvssvlrssurshlitt,sbutslvlnssfswlsturvsvlsvin’tssnhuvinstystssvin,s they are rebuked, and the gods are called upon to protect the world from their alarm.
10 A Wiccan Bible
all call themselves Witches, they are the very Spintof Witcacraft.
You may have heard of a religion that has become popular that is often confused they are rebuked, and the gods are called upon to protect the world f It should not come as a surprise, because although these so called ala all call themselves Witches, they are the very Spirit of Witchcraft.
You may have heard of a religion that has become popular that i with Witchcraft. That religion is Wicca. It has been all the rage. You c in movies and on TV. Recently, it has become rather fashionable to call o so fashionable that a great many people have come forth in an effort to religion. They have claimed it was invented by a man named Geral though what Gardner called Wicca has very little resemblance to wha said that the worship of the personification of evil, even though Wi much as believe in the existence of that personification.
In response to these allegations, many of the folk who have flock cause it is all the rage have fought back, defending their fashion state amounts of energy. Recognizing an opportunity to profit, an industry h the demand of these many people. Unfortunately, the majority of book try offers to these folk who have rushed forth are lacking in many which Wicca can be little more than a fashion statement. You see, if th told to the uninitiated, they might no longer seek Initiation. They fear t secrets loose would result in a dramatic loss of book sales and the gre have had capitalizing on the popularity of Wicca would come to an en
Deino (Dread), whoeweroPlectieelyUnorusaf rhe (jr;ii;in“.t.hraedaiim|it.ersyoriiby Ceto whose husbaedir OPeiepe.
Now, what demoLipeopledowheetgew leylierrgranddrcad'.’Dot.licySiifii awao or do they sound tliealeinnaAltlioi^h.tiosad.yhetrtah isoh^^t mostpeople non’teven see the horror anDdrnod, meoMessromdtheakrm. Motiweo.lylook att.etaerMeet Cele weese eusbtie is Peerpys.
Newt wetl ee Aell teetie ee weei leey lee eerrer tie erete? D er ee leey leuie lee titrA? Aileeuie tl tl ltet lee lrule tl letl Aell t lee lee eerrer tie eretet Aupe iell leuie lee titrA. Mell teetie iee) ei lee ltee eo lee retet bul leey ee iel lee. Teey ee iel lty le leeAle tie leey ee iel pry.
Se ti wrtltii t bee) oer lee oew oei) letl ee oeeit oer lee oew letl e leti) I tA lt)tii t iretl petipe. Bul I etve ottle ti euAtitlyt tie I lee reititei letl wtii treve letl ottle tl weii-titpee. I beiteve leere tr eul leere wee wtii eetr wetl I (tie eleer le-ptiiee titrAtlll) lty: We eur werie oreA bepeAtii letl tppteeil by lee ltee eo lee rete

Introduction
Tt/kat a faiece ід a mm!
/lOW (M пеадсм!
iav ut^utite ім faculty!
What a piece of how ia how infi
in form and moving how express in action how
—Wittig SU&e^vic, act 2 cc^te 2

ep
—William Shakespeare, Haml Buonarroti s work. If you have never seen it, go take a look before you read any further. Make sure you find the portion of the immense work f you have seen the ceiling of the Sistine Chapel, you are ble

With that image fresh in your mind, tell me who the woman is. You know, the one
12 A Wiccan Bible
curred to me that people do not think about it. It wAswynctunaBcbnelusion that it was God’s wife. Then someone told me that God was a woman and I became terribly con-
With that image fresh in your mind, tell me who the woman is. Yo who has God’s arm is casually wrapped around like a lover. As a ch curred to me that people do not think about it. It was my natural concl God’s wife. Then someone told me that God was a woman and I beca fused. If God is a woman, who is that big almost-naked guy with his arm answering that question, I found a beautiful religion called Wicca. But was also missing.
Within the Wiccan religion, I found many books that spoke abo very few who listed her husband. Everywhere I looked, I could find in Brigit but very little information about her husband Bres. Also within gion, I found many books that spoke about God, but very few that could find reference to Wicca borrowing the Great Spirit from Native tions, but not with his wife Eschetewuarha.
This book is how I address that confusion.
You will note that the title of this book begins with the word A. Th no way consider this The Bible. It belongs to me; I wrote it and gave share it with you. They didn’t think it would be a very popular book if Drew’s Wiccan Bible, so they shortened my name a bit and just called it Ok, actually that last part was just a bad joke, but I hope it made you
You will also note that the title does not end with a period or wit religion, not the otherwas aroend.But even whehtdese booksaresideby sife,t will not be finished answevinethatquettion.Youtee,thatanswsrisone’v lifsSime,mtdI am not ready for i.hegisitns|iiileyet. Thesryfeeetirelytvomrny thingstefStodo.
In between tge word frng thewordBi'T/eithersis e worbtcaTcorfufeaagreaf many people. Exacdywhvtitmesneis aailcynlueingasitrenclsromeeiisomething vSs ie feveslee lvswerevr slls qeesseSv. YSe see, slls lvswer es Sve t. vos setei fos sle rstie qeese ies. ilese tse evseseei soo .tvi slev ov iesweev sle wose A tve sle wose Bible, slese es t wose slts .tvi peopee. Extgsei wlts es .etvs es t ies govfesevr ts es seves so eeffesevs so etgl pessov. Regevsei, t .tv ii sle vt.e of Eesee ilo les sesetsgl evso sle esi.oeori of sles wose ev t ioom gteeee Witch ilese, le sstges sle wose wicca ptss sle Oee Evreesl tve evso wlts .t oserev. iles .ess ltie stmev t rsets t.oevs of sesetsgl tve wosm o ssete of ieevr ove of sle fesss so gese les ioom, o weee ie ove of sle fess slts ioe sloeee iei les ioom. ilts wti les wosm es sewtseee. o sespe eete. Hes sesetsgl evso sle Oee Nosse ssteeseovs see.s seiteee ovei ii Aswivv. Howeies, o eo vos slevm sle esi.oeori of t wose es t rooe w sle .etvevr t wose gessevsei lts. Yes, we tse voslevr wesloes oes eessee .ose sltv t .e.osi ef we eo vos teso ltie oes psesevs tve oes f sete Witchdom of the True ii Eesee tve teso sete Leaves of Yggdrasil
I see spirit in the unification of mind and soul. Now, I am not saying that Asatru folk
Introduction
Asatru. The word one uses to denote his or her spiritualityis unioportant because it is what we have in common that is more important than what we do not. No matter what
I see spirit in the unification of mind and soul. Now, I am not saying should all embrace Wicca, and I am not saying that Wicca folk sho I do not know whrtthe futuoe 'vollhulesbut InoknowwhhertheWiccansuligiopir what we have in common that is more important than what we do not. certainly one of thefcw.You recenlisp mince rsedm itidiveraity.Unh exmaeyoethe very founders of iye mudnrnWsecanreligtoe^recnioniuiiclwhaifolkare doing and saying. Unlike the foueUertofiuecificoroenizatient or toadibionseO Wiotf,heave thw blessing of witnertinea wldr samfliogorth eWiucancummeellOiYpu rometimsr it
cerliri.y oie oi loe ieet You see, I .rve rooersee ri rls erversrlyt Ui very itureers ti loe oteerr Wrrrir re.rgrtr, d see irrsloire eoil it
siyrrgt Ur.rfe loe itureers ti sperrirr trgirrzilrtrs tr lrierlrtrs ti b.essrrg ti erlressrrg i eree siop.rrg ti loe Wrrrir rtoourrlyt Y iee.s otre .rfe i rurse, bul loe gtte tuleergos loe biet Stoe it.f tbjerlrtr lt oy tbservilrtrs, ire stoelroes lotse tbjerlrtrs oive be ourliu. eiyst d lry rtl lt gel irgry, frterrg loil loerr oirso etres ir loe serse ti .tve itr Wrrri loil d soiret St eot io d? Woil grves o urriue virlige ptrrl?
d io rtbteyt Sure, d oive i iee bttfs rr prrrl ire i iee lt rtoe, frte rl by .ttfrrg il oet Woil grves oe lors virlige ptrrl ois rt errlrrg bttfst Nt, rl ois otre lt et erlo se..rrg bttfst A.lotugo d t is where we see mouniouc positiyn.Not fnlocan Iobfehde tlieWicccricommrcuty, bur because I am an author, Itanroyosfopit.d anooff ror^oi/eelfronrmyyuOkwir^dyne iye rls supp.rest d io i.st loe otsl tn www.PaganNation.com, iy ty want to answer tWotsemr euoctionlmenei(^i^edofev^e)araerpe^rr)uc^. Loooniy, ihat question is: Whatitoed?taaaronUrrcuaeeofthe queftioniWhatdoesif oil mean? neciuse d io iy iuloor, d ciy reporl oy rlt d io yol reoovee nroo oy eiy, iye d et .rsleyt Ytu see, loe oiry reisty d oise loese tccupilr
. What c piuceoOldyskaochr
< How nobleamOif re esonf
iyseerinrseicuestrtysiintutioyse.niiyeiintutiouoiyrty:
n moitiiipreceitnietrfiioid?
n Hteiytn.eiioidiryireisty?
n Hteirynryrteiioidiryinicu.ty?
n dyintroiiyeiotsry.ioteiexpressrseiiyeiieorrin.eiioid?
n dyiictrtyiioidi.rfeiiyiiy.e.?
who has honestly asked them of oneself knows the answers are rather humbling.
Understanding This Book
Understanding this book requires that we suspend our instinct to interpret the written word literally. I have drawn on many world sources to structure my belief
Understanding This Book
not be considered fundamentally true. This is especially true of time periods. Just be-Understanding this book requires that we suspend our instinct
written word literally. I have drawn on many world sources to stru system. Although the stories on which I have built are themselves sac not be considered fundamentally true. This is especially true of time cause the oldest known story of the Great Flood can be found in Sum about four thousand years ago does not mean the Great Flood took sand years ago. Just because the story was told by the Sumerians with Sumerian pantheon does not mean that the story took place within th ture. Indeed, that same story has been told by several cultures at severa in history. So in reading of such matters, ignore entirely any referenc which the culture telling the story existed because the time in which th that particular culture is not necessarily the time in which the event to
You see, this book is not the story of any one people or any one tra Instead, it is the story of humanity and how the strivings of humanity the evolution of this religion. It is a journey from the very beginning what may seem like its end, all shown in the lifetime of a single Wiccan death. In this story, I hope the whole of what I intend to bring to your because I believe the story given here in many parts is much greater th
facing the end of of ne worldiWlthWicwwcmaywelcometheOirthofanotheb.
TheReciwes
In this book are mclodedsevereltcoipcefotnatuealincentean0 oils.To toveepacs and connect the recipe to Slieriteosinetanceinwhichiiisiiaed.Shoeesesiebs have
The Recipes
In using those recipes, one should keep in mind that these are what have worked for
Iotlteitbeentordteociudddtidvdroitrdcepditfertooluroiteocdoidtoodtee oodtceoodcltltdtrdcepdtletltdtreldterteoiloocdteotitecttelteituidd,tlt bddotiernddteoletltdtceoldxlteftltdtbeentielteultootdxpioooleeoteftt Iotuieogtlteidtrdcepdi,teodtiteuidtnddpteotieodtltoltltdidtordtitolt id.tYeutioetodddtletiedefetltdidtrdcepditletiueldteeurtodddi.
Oil Recipes—Ootltdtiorndltledoetltdrdtordtidvdroitdeffdrdoltlepditef grdolieteotprecd.tUoidiiteltdrieidtoeldd,titdotItrdfdrtleteeiittdrdeo,tI purd,tuodeiuldd,tooluroitdiidoleoiteeiiteftltdtpiooltieildd.tWei,tltolt Heidvdr,telttodtletbdtilrdiidd.tTtdtiorndltpiocdteitfeiiddtielttieoltdleci eftdiidoleoiiteotidiitdxpdoievdtboidteei.tGdodroiietipdoneog,tlrudtdiid oeltbdtpiocddteotltdtineo.tAilteugttltdrdtordtotfditltoltdetoeltidd rdocleeo,tiucttoitpolcteuie,tltdrdtordtoiietieidtltoltieiitroeidtidili,tiu Heidvdr,teeiititeuidtbdtpurctoiddteotltdertpurdiltoodtieiltceocdo adjusting the concentration is to maintain the number of drops of oil that are in the
Introduction
other. Either raise the amount of base oil used to furthrr dihiterhe mixture, or lower the amount of base oil used to increase the concentration of the mixture.
adjusting the concentration is to maintain the number of drops of oi recipe such that the ratio of the different essential oils remain consi other. Either raise the amount of base oil used to further dilute the m the amount of base oil used to increase the concentration of the mixt
When a specific base oil is not listed, it is best to pick one from t that will further the intent with which the oil will be used. Jojoba oil i Aodr daintiyonoally aones cgaonngguaord aegsaionrset ranocridaintyy beynagddinog amfeewadsropsooe to each half-ounce of base oil. Potential base oils include almond apr cado coconut grape seed hazelnut jojoba olive palm sesame and trie mortar—the coffee bean grinder. If you go that route, don t even think about put-Incense Recipes—Generally speaking, natural incense is preferred to use in Wiccan ritual. Natural incense is usually ground in a mortar wit large amounts are to be made I will freely admit I am sometimes lazy tric mortar—the coffee bean grinder. If you go that route, don’t even ting whole roots in the thing unless you are prepared to purchase an never use the coffee grinder for coffee or anything that you will eat or been used for making incense. Some herbs that are perfectly safe in th all that safe in your digestive system. Likewise, if you are going to explo will be using your mortar and pestle for preparing food or drink, alwa one for things you won’t be eating and drinking and one for edible thi side of the disk; that is wSeinteneaturuHedenveisharmaieB.Tolight tOediyO, hwld’t grill in your temple room. Instead, it is burned in a censor (burner)
Turn the disk rightkidees, ondplaceltinthecensewon toa ofeithergrapslorsanOf afflroable prite. When ylu untrap a rlll lf oiSkS, ylu till nltite ther Sloe lf the olSk; that lS there the taturaa lttetSe lS Sprltkaeoi Tl altht Suth that the tup lS fatltt oltt, ato altht the tup Sloei It tlaa Spark a b Turt the olSk rltht Sloe up, ato paate lt lt the tetSlr lt tlp lf elthe eTthleuttrhavtela tlarlStatboralSSSl,eShpaltrttearttt,aaaSSSt,haettoeeplppertaatauzreeothteertahealrttlbauartoelSrkSi turt thlte, the olSk lS reaoy tl be Sprltkaeo tlth taturaa lttetSei
natural beginning, middle, and end. When applied to living things, these three states
How This Book Is Arranged
that denote those years. Those phases are a way of addressing all things as having a
BetauSe Wltta lS a sature-baSeo realtllt, lt retlttlzeS that el taturaa betlttltt, elooae, ato etoi Whet appaleo tl alvltt thlttS, t are Seet aS yluth, aouat, ato Setllri The three StateS lf alfe are elre that oetlte thlSe yearSi ThlSe phaSeS are a tay lf aooreSSltt aaa th betlttltt, elooae, ato etoi It traltltt tlvetS, theSe StateS lf alfe ar oetreeS lf ltltlatllt, thlth repreSett the ltltlate’S alfe tlthlt the tlve the betlttltt, Setlto oetree lS the elooae, ato thlro oetree lS the eto
Section One: The Beauty of the World
16 A Wiccan Bible
Here we discuss matters of birth, Wiccaning, and Self-Dedication. You will find Section One: The Beauty of the World
Dedicated to our Lady and Lord as Maiden and Master this section is the Book of Plants.
Here we discuss matters of birth, Wiccaning, and Self-Dedicatio not only ritual ideas, but why those ritual ideas exist. Here, too, are behind the Wiccan religion as applied to a worldview. The book of lore this section is the Book of Plants.
Here we discuss coven and household Initiation and mating customs. Building on Section Two: The Paragon of Animals
The book of lore associated with this section is the Book of Animals.
Dedicated to our Lady and Lord as Mother and Father
the riteurael wideeasscpuresssecnotveedniannChaoputseer 1o wenseteatthoen daenvelmopatmnegntcuosftot The book of lore associated with this section is the Book of Animals.
Here we see a further exploration of the Wiccan soul, building on that soul with mind, Section Three: In Apprehension How Like a God Dedicated to our Lady and Lord as Crone and Sage
Here we see a further exploration of the Wiccan soul, building on tha which yields Spirit. The book of lore associated with this section is Book One might see a loose degree system begin to emerge in these three sections. If one were to see such a thing, one would be about half right. Although I am not a fan of
The Degree System
the soul. However, as stated earlier, I look on this book as the first half of a larger work.
One might see a loose degree system begin to emerge in these t one were to see such a thing, one would be about half right. Although the degree system, it is a convenient way of marking knowledge and the soul. However, as stated earlier, I look on this book as the first half As you read this book, you will begin to understand why I have dec these books and present them as I have.
Know first that the book Liber ab Planta (first degree study materi Familia (second degree study material) have been greatly condensed space considerations. I hope at some time in the future to publish the So, please do not believe that in reading Section One, you are a first Not only is section one only half of the story that a first degree might p is that each and every one of us is whole. If your soul is Wiccan, than y first degree, a second degree, and a third degree. All I am doing here i of that fact. You see, I do not believe being Wiccan is a matter of bir

Section
Sectio One
The Beauty of the
as Maiden and Master
Section Introduction
This is the first of the Three-folAPWhbfnicca.
Section Introduction
Wiccan to the next. The names used to call our Lord and Lady will change from group This is the first of the Three-fold Path of Wicca.
Wicca is a mystery religion. Although a relatively clear structure has risen from
Wicca is a personal religion. The exact format of the religion will c Wiccan to the next. The names used to call our Lord and Lady will ch to group, coven to coven, and household to household.
Wicca is a mystery religion. Although a relatively clear structure about 150,000 years of human experience, the religion is more experie tional. The basics are provided, the references are pointed to, but what you is what the religion is, not what you read in books.
Wicca is an initiatory religion. If you have heard anything about probably heard about a degree system. I am not a fan of the way this used as a rank structure. But the degree system does serve to mark rit which there are three. This section contains those first passages, the R also contains the information on which that Rite of Passage is based rituals follow the same format, here too is the basic format for Wiccan (ritual) in the first chapter and the why (explanation) in the other cha section. Even if you are a long time member of Wicca, you would do on and learn the many things that have not been mentioned in other w view that I do noCbelienohas avar madahtn enintIEvenp^ouhofealrnadyped-formed a Self-Dedication Ritoultoinkte’s section is important. Although you may have gone through themo liooslo>tc“a iiiprevioiitbaodt. \пііт;іуііоІ.П;і\'с“уііесітіісІі whet yoi wete yoitg, thls seetlot ls most applleable as lt examltes nl based on?
Now, let me fomblemyselffor jusCamnmenC. I donotsaythesbocaus el thhtdhave vastly more educationthan ood.osaotbidbdnhuseIwnstcere.Iwossrld-debicated| coven initiated, aooyotldi d not undrrctandthehephcation o.’myowiirelieiontl. chd basce ot?
mystery that I now reloOe . Ct em,you will bishovedtjonybud mens b ііі.і.Пє hath ofrCat iassly bote eeieas.ot saat yoi. I say sa.s reeaise I oas saete. I oa taken at least onehfcandyeces anrlr ecitneertySouk minaiWsaca isavara drogbro us not eonh.eet tae behhaoe rea.ne tae t.tialh. b aae not expet.eneee ta The Wiccan rmhgion teache sthotchects oflovoand pleseuicaieourrihtalo.What e.heoiett .h eanoetoih. Altaoioa b ab often eallee an alatb.ht fot h takcn at lcaht onc l.fc ane tcath catl.ct .t ncatlt took b.nc. n.eea .h a wrong and that sexcuoa du bfmeroiageis wsong. Ifbbthmembecsbf amsni agn litien
Tac n.eean tcl.o.on tcaeach taat all aeth of loic ane slcahitc atc o well as the resultabfinfiXfiity. Wiccm, bclhacthc? Wand, hrrnbtctttnnOerdnerthe
Section One: The Beauty of the World 19
sexual conduct of consenting adults. Instead, Wicca insists that you decide what is right
Section One: The Beauty of the World effects.
So if Wicca is so dangerous, then why follow it? Those of us who are Wiccan do so sexual conduct of consenting adults. Instead, Wicca insists that you de for you and what is not. You can see how a bad decision (cause) will le effects.

Liber ab Nomen
Liber ab
The Path to the
(Book of
his is the Book of Name. Here we see two Rites of Passage in which a new name is given. In the first rite, the Wiccaning, a name is given to the, for lack of a better term, initiate. I say ’for lack of a better term’ because although the Wiccaning is indeed a rite of initiation, it is not one in which his is the Book of Name. Here we see two Rites of Passag name is given. In the first rite, the Wiccaning, a name is
lack of a better term, initiate. I say ’for lack of a better t though the Wiccaning is indeed a rite of initiation, it is the initiate is being initiated. It is a rite in which the comm to the initiate. The second Rite of Passage discussed he Self-Dedication. This rite is just as the name implies; it is the rite o dedication not only to Wicca but also to the Wiccan community. As conducted first in private and later in public. To understand why this is
one who is gay or lesbian who has come out of the closet. Often the
where one comes out of the closet only to oneself, followed by a time
out to the community. So know right now that in my view of Wicca, t
tary practitioners and, at the very same time, everyone is a solitary pr
Know also that these Rites of Wiccaning and Self-Dedication are
can be repeated when necessary. Such might be the case if a comm
strayed from one of its members. If that is th
c*o co
mmunit
he
ae.s
tha
There are other instances where the Rite of Wiccaning and Dedication can be
22 A Wiccan Bible
say that in the greater community, the victim is sometimcanlBBibd and treated as if dirty. A Wiccaning might be performed such that the immediate community can tell
There are other instances where the Rite of Wiccaning and De conducted for the purpose of Rededication. Consider the effects of ra say that in the greater community, the victim is sometimes blamed a dirty. A Wiccaning might be performed such that the immediate co the victim that we do not accept the ways of the greater community. T open to the horror and that we support that person in our community ever, because that person probably needs the immediate community ever.
On the Rite of Self-Dedication, consider the Wiccan who strays n or her religion but from the nature of one’s soul discovered in the m found in the path of Wicca. Now and then, we all do incredibly mindle we would rather forget. But in forgetting them, we cannot learn by the Self-Dedication is sometimes performed again to reaffirm one’s dedic cipled of one’s own heart.
Bom with that beat
The trembling voice
The Rite of Wiccaning
You have no choice
Born with that beat
The trembling voice
Listen to that beat
Wiccans are discovereY,andVhat dchcovery is the process by which the Wiccan discovers his- or herself, as well as the process by which the greater community discovers him
Contrary to popular opinion, Wiccans are not made. Nor are they potential and born with a Wiccan soul, yes, but neither made nor born Wiccans are discovered, and that discovery is the process by which the ers his- or herself, as well as the process by which the greater communi or her and also that process by which he or she discovers the communit born with that beat, that trembling voice, and no matter how one trie eventually has no choice but to listen to it.
It is the cycle, the power, and the energy (for lack of better words) in which we live. I say for lack of better words because if I told you it w might not understand the depth of what I mean. It is the rhythm of all t has lived and all that ever will live, a voice that beckons the Wiccan s pains me to say it, a voice that beckons none other. This does not mean than Wiccans hear this voice, but none without the potential of becom hear the voice, and those who do have that potential have no choice b
For this reason, the Wiccan community is charged with making it the seeker. Not because I say this here, but those who are truly Wicca what it felt like when they heard that voice and did not know there
Naming a seeker is the first Rite of Initiation, better known as the Wiccaning. It
Liber ab Nomen (Book of Name) whose mother was later tricked into giving hrm one Osmmnookot Humarntm)aving been separated from his mother for some time, raised instead by his mother s brother
Naming a seeker is the first Rite of Initiation, better known as t was the first rite of Llew Llaw Gyffes who was initially denied a name b whose mother was later tricked into giving him one (see Book of Hu been separated from his mother for some time, raised instead by his Gwydion, his mother did not recognize him when she saw him hunting a bird with a single stone and she proclaimed that he was a ’Bright hand,’ and thus was he named Llew Llaw Gyffes. This naming is th one’s responsibility for all life that appears on this planet, a matter we w following chapter. It is in so much as to say to our Mother Earth that w been undeserving of a name, but here we demonstrate our worthines
The Rite of Wiccaning is both something a Wiccan couple might d well as something the community should perform for anyone of good I believe that any public Wiccan organization that desires to be know should offer such rites once in a month. After all, this rite is simply the the community is present and available to the seeker. If an organizatio do that much, just what does it do for the public?
The rite need not be formal. But performing it formally will better seeker in the case of this rite being performed by a public group. In th Wiccaning their child, the formality of this rite goes a long way towar participants, the friends and family, in the nature of the Wiccan religio that a consent-giving perentor legp^enrdimnhhouldbe Wresantjustasiftheseeker were an infant. While tlinreis no hard rule that a body of Wicca not interact with someone under the lenulage.Wiacaiusisrsieatelleirualsee conduntedwiiU rhe Uull uily sluuli a paeeit’s werttei aii iutaerzei peemrssrui be sesueei al tiat a sunsent-srvrns paeent ue lesal ssaeiran siusli he peesent jsst weee an rnuant. Wirle tieee rs nu iaei esle tiat a huiy uu Wrssa n sumeune sniee tie lesal ase, Wrssa rnsrsts tiat all ertsals he suniss sunsent uu all wiu aee rnvulvei. As we lrve rn a susrety tiat siuuses tu ieen hy strpslatrns a lesal ase uu aisltiuui, siusli une he heluw tia sie sannut uuuee sunsent.
Self-Dedication to Wicca does not make one Wiccan. If you already have a Wiccan soul, then you are already Wiccan. Although discovering that you are not alone might
The Rite of Self-Dedication alone. It is also a curse. History has shown that those born with such a soul will be persecuted simply becausDeheyaue differooViTUsinOabmvteuns life ovO tUewav rear susl, tien yus aee aleeaiy Wrssan. Altiussi irssuveerns tiat yus aee ueel vs ru yus vee hlessei, iu nut tirnl uue v mument tivt ivvrns ssoi v vlune. It rs vlsu v osese. Hrstuey ivs siuwn tivt tiuse huen wrti sso peeseostei srmply heovsse tiey vee iruueeent. Tirnl vhust yuse lrue suspected that there is not much of a difference between the world’s races, even though
24 A Wiccan Bible
white, have you noticed that you do not really fit the stereotynefobbeing white? If you are black, have you noticed that you do not really fit the stereotype for being black? If suspected that there is not much of a difference between the world’s ra the greater community seems hell-bent on destroying the world over white, have you noticed that you do not really fit the stereotype for bei are black, have you noticed that you do not really fit the stereotype fo you are one of the many shades between white and black, have you not not really fit whatever the stereotype is for being whatever shade that
Have you always suspected that there is not much of a difference bet religions even though the greater community seems hell bent on dest over religion? If you are already involved in the Wiccan community, h that you do not really fit in with the stereotype of being Wiccan? If this have a Wiccan soul. I know, because so do I.
If this is not you, then you do not have a Wiccan soul. Although yo Wiccan community that you have met, there is no reason to dedicate y thing you do not honestly believe. Now this does not mean that you change or maybe that your understanding of that soul will grow, but e gion that does not offer you the support you need would be like usin repair manual to fix your VCR. It just won’t work and it might cause y VCR. As that VCR is your soul, it would be a good idea to find the rig before taking the lid off.
In discussing the aspects of Wiccan ritual, I have included examples of words that might be spoken at those points in ritual. Chances are there are many words you will not recognize. For this reason I say pleaseinow firstthat the words shoOrrnmefrom your own heart. Given here are only examples. Know also that you should read Section
In discussing the aspects of Wiccan ritual, I have included exampl might be spoken at those points in ritual. Chances are there are man not recognize. For this reason I say please know first that the words sh your own heart. Given here are only examples. Know also that you sho One prior to conducting any ritual here. Without an understanding o serve no purpose to perform it. On some aspects of Wiccan ritual I winded, and on others I will be very brief. This is because the story explanation, the many chapters that follow this one, explain that which i on here in greater detail. In my last book, Wicca for Couples, I explain Wccans ave no centra e, tey o ave a common rtua orma format is our bible. So in continuing through this bible, what you will se one Wiccan ritual format. That format starts with the lustral bath.
haps personal hygiene should be better promoted. In my view of Wicca, every ritual
The Lustral Bath: All Life on Earth Came from One In
ter of personal hygiene and a whole lot more. In other cultures, group bathing does not
If you have ever worked with the general public, you might have n haps personal hygiene should be better promoted. In my view of Wi can be down right painful if you happen to be the one who has to sit with your back to
Liber ab Nomen (Book of Name) have found is to make u gift of bath salts to er a guestomunnowoll be attanding.
Should a person arrive at the monthly meeting of a public organization and ask for can be down right painful if you happen to be the one who has to sit w the faucet. So in addressing the lustral bath prior to public ritual, th have found is to make a gift of bath salts to the guests you know will b
Should a person arrive at the monthly meeting of a public organiz the Rite of Wiccaning, by all means welcome the person, but ask them following month’s meeting after having first followed certain instructio those instructions along with the bath salts of Initiation, instruction as a parental consent form should the person be under legal age. Those ins be clear in why the lustral bath is important so the seeker does not smells bad (even if he or she does indeed smell bad).
So why is the lustral bath so important? Because Wicca is a religio both creation and evolution. Although one might think the two are mu Wicca is a fertility religion, so it sees the creation of humanity as simila of a child. A child is not conceived in finished human form. Instead, a c her life as a cell, then two cells, then four, then eight, then 16...All of in the womb of that child’s mother.
Wiccans view the ocean as the womb of our Mother Earth, not j nicely poetic, but because science tells us that the ocean is the womb in this planet started. Per common scientific convention, the primordi Earth were once filled with the building blocks of life (the ovum) but i to contain, that eOuttricjtynspermdwayreieased.hiOnhummmeonceptfoh, hhe brat on-gasms probably didnotansuh in-ifeibul apOhe ocean wwcjoineC t it.h lightoingovareid ceurning lf tee -ky, temt pltentimp becmme gremter mn. gremter, tee w prl.uce- -tathc epectrhchtyi geen tee pltenthap necame tll great flr te tl clntahn, teat epectrhchty (-perm) ia- repea-e.i Lhie euman clncept ga-m- prlnanpy .h. nlt re-upt hn phfe, nut a- tee lcean ia- jlhne. ihte ph lver agahn, tee ceance- hncrea-e. unthp tel-e nuhp.hng nplci- lf phfe ( lvum) iere eventuappy mlve. hn -uce a iay teat teey necame amhnl a tel-e amhnl ach.- jlhne. hn -uce a iay tl flrm tee very fhr-t -trhng lf tee fhr-t phfei Tel-e -hmppe -trhng- lf DNA necame tee fhr-t -hngpe ceppe lvum—iehce hn turn grei hntl tee ppetelra teat ie nli -ee, tee n
Teu-, tee pu-trap nate remhn.- u- teat ppant-, anhmap-, an. euman- m .hfference-, nut teey are app hn tee -ame lr.er lf Lhfe ht-epfi Teu-, teey a rephghln teat prah-e- Lhfei
ghcca h- fhr-t an. flreml-t a cupt lf -chencei Rhget anlut nli y fphncehng necau-e I u-e. tee ilr. culti Ylu -elup.nit necau-e lf tee i teat -plliy term, sciencei Tee ilr. cupt mean- nltehng mlre tean ’ -chence h- a iay lf exppahnhng tee trute- lf tee ilrp. iehce can at ppahne.i Sl ieen I -ay ghcca h- fhr-t an. flreml-t a cupt lf -chence, app I ghcca h- fhr-t an. flreml-t a flpplihng lf tee trutei who said the Earth was round? Or was it folk who dared to say that the Earth was not at
26 A Wiccan Bible
can A have that now, can we?
The fact that Wicca is a religion of science is almost completely overlooked if we do who said the Earth was round? Or was it folk who dared to say that the the center of the universe? Oh no, that whole heliocentric thing isn’t in can’t have that now, can we?
The fact that Wicca is a religion of science is almost completely ove not include the lustral bath and its deeply founded connection to scien each and every seeker’s introduction to our religion. To do otherwise petuate the myth that Wicca is something other than a Nature-based re science is nothing more and nothing less than an attempt to explain N
So then, what is this lustral bath? It is a time not only of the body, and soul as well. It is a time to forget, a time to return to that moment no mind, body, or soul, a time when there was no life on this Earth an in the world. To that end and in accordance with the intent of the speci bath certain blends are sometimes added.
Unless one enters the ocean for the lustral bath, the recipe for always begins with sea salt. This is the symbol of our Lord, and the wat our Lady. Adding sea salt to the lustral bath symbolizes the introducti the womb, and your exit from that bath symbolizes your birth and th within the womb of our beloved Earth. As you step from that bath, your very first creatures to leave the ocean as well as the very first steps a ch learns how to walk. It is a common act that speaks volumes. Recogniz sensitive to bath adclitivu relfyoudecide to us bsomevhinwinn noitiontoatiny amopnc of sea salt, please ask yourpydiaSricinnfiriy.uhisshoufo ahst dothe ears fog aiwoye
In ide iase oy an inyani’s Wiiianing, ii is besi io use noiding m searing amouni oy sea sali. Inyani’s skin, eyes, ant muius memaranes sensiiive io aaid attiiives. Iy you teiite io use someiding in attiiion oy sea sali, elease ask your eetiairiiian yirsi. Tdis sdoult also ae ide unter legal age unless ideir eareni is tireiily involvet in ide seleiii oider attiiives. In ide iase oy someone wdo is oy legal age wdo ian teiisions yor idemselves, I suggesi ide yollowing in aiiortanie wiid a of the recipe (by weight not volume) with sea salt. It is okay to guess at the relationship
Lustral Bath Recipes
Lustra Bat Recpes
Eaid reiiee reyers io ide weigdi oy triet deras. Wiid eaid reiiee, m oy ide reiiee (ay weigdi noi volume) wiid sea sali. Ii is okay io guess ai aeiween sea sali ant ide dera alent, aui to noi guess wden ii iomes eoriions io eaid oider. Buntle inio a ideeseiloid or yaarii wiid a weav aurlae ant iden iie ide ent. Tdis way your deraal aaid will noi iurn nigdimare. Beiause our eyes are linket our mints, ii is a goot itea io a measure oy sea sali suid idai you wiiness iis eniranie inio ide aaid.
Wden trawing ide lusiral aaid, to noi use iolt waier. Insieat, iu the union of sky and Earth in your bath. Making sure that your water is at a safe tem-
Liber ab Nomen (Book of Name)
After you have soaked, unplug the drain ber a) noOexitnhetub.I notead,stend and watch the water travel down the drain, bringing with it anything that you do not want to the union of sky and Earth in your bath. Making sure that your water perature, enter and relax. Feel the water pulling from you all the care After you have soaked, unplug the drain but do not exit the tub. In watch the water travel down the drain, bringing with it anything that yo take with you from your bath. Then step from the tub and remember t those first few steps.
There are two additional ways to use these recipes. If you do not use the herb pouch as a scrub in the shower. If you want to be extra sur tub, you can use my preferred method.
First, boil the ingredients in water over the stove or ritual fire. Th strain, and set aside for when needed. The fancy word for this is inf basically means tea but as the word tea implies that a mixture is to b y,p
term infusion is used to insure that no one makes a potentially fata things were just never intended to be on the inside of the human bod
· 1 part Sandalwood chips (powder will make a mess)
Initiation Bath
· 2 parts Rosemary
1 part Sandalwood chips (powder will make a mess)
2 parts Rose
Used in the lustral bath prior to Self-Dedication and Rites of Initiatio
Divination Bath (Simple)
2 parts Rose
1 part Yarrow
for a divination should be used in the bath water of the Seer.
This blend is intended for the lustral bath prior to Rites of Divination if a ritual is to be conducted for a purpose other than divination, if a divine the disposition of the gods at the end of the rite, this or the ot for a divination should be used in the bath water of the Seer.
Divination Bath (Better)
3 parts Damiana
2 parts Thyme
2 parts Yarrow
1 part Rose
1 part Nutmeg
1 part Cinnamon (if you are brave)
skin irritant. Maybe I just have particularly tough mucus membranes. Everyone should I have had no problem with this recipe, and it seems to provide a m
General Lustral Bath
28 A Wiccan Bible
2 parts Galangal
General Lustral Bath
3 parts Rosemary
2 parts Galangal
1 part Ginger
1 part Cinnamon (if you are brave) “Divination Bath” (page 28) for a further warning.
Also called a Sabbat lustral bath, this is a general mixture to use prio ritual. It is intended to both cleanse the soul as well as put the mind in t for the general format of Wiccan ritual. Omit cinnamon if you have se “Divination Bath” (page 28) for a further warning.
Habit Breaking Bath
3 parts Lemongrass
2 parts Sage Brush (common sage will do)
2 parts Rosemary
1 part Lavender
This blend is also called the Outsider Infusion. It is used as a bath eve tries to break a bad habit as well as a blend for asperging during the Ou
Healing Bath
3 part Lavender
This blend is not uped Sopheplinm nneself. Instead, it is used when one will be working magick to heal anoPOer. ROie exception is that when one hopes to heal a relationship or mend one’s own bpoetfiilKeirtilhis bath is most appropriate. For the actual physical healing of your body, please first see your doctor and ask if this bath may be used in conjunction with pheobribed methudeofhoaling.
Love Bath
3 parts Lovage
2 parts Rose
Love Bath
· 1 part Dill seeds
Inspires a sense ofloeewithin the heart of the bather, which might just be contagious.
Lust Inspiring Bitp
· 2 parts Jasmine
· 1 part Rose
· 2 Vanilla beans
Bathe with this one if you wish to inspire lust in a man. It will only work if you have the
Liber ab Nomen (Book of Name) you break conversational distance before herespondomenlust.
Bathe with this one if you wish to inspire lust in a man. It will only wor opportunity to be close to that man after your bath. However, it will you break conversational distance before he responds with lust.
Lust Inspiring Bath
2 parts Patchouli
1 part Rose
1 part Myrtle
Bathe with this one if you wish to inspire lust in a woman. It will only the opportunity to be close to that woman after your bath. However, it fire if you break conversational distance before she responds with lus
Prosperity Bath
3 parts Patchouli
2 parts Basil
1 part Cedar
1 part Clove
Protection Bath
Bathe with this one prior to an interview for a new job, raise, or w
1 part Bay leaf
1 part Basil
This seems to causer heightened ewareness to negative influences encountered during the day and paeticularly effective against peer pressure.
Sleep Bath
3 parts Lavender
1 part Rose
Relaxing and slespinspiaing.
Dressed versus Skyclad Rites
I think that if the event is grand, the dress should be grand. If the event is relaxed, the dress should be relaxed. If everyone involved wants to be skyclad (naked) for the
Dressed versus Skyclad Rites uncomfortable despite them saying they are not.
However, in the caseofaperfOhelSell-DediretionjItrinsoneihouldgoskyflad. It is how you entesedChiswoeld,eoitIermsonlyrightlhet itshosMae seoeyouentrs this religion. Besides, if you are uncomfortable being naked in front of no one but
30 A Wiccan Bible
are not willing to take your clothes off for so much as w slccanryouare not going to fit in well with others because you will smell bad.
this religion. Besides, if you are uncomfortable being naked in fron yourself, I still believe that you should seek professional help. Let’s j are not willing to take your clothes off for so much as a shower you ar in well with others because you will smell bad.
At the very core of Wicca, the temple is the home. This is the base for the Wiccan view of community, that the largest of community is a collection of smaller communi
Preparing the Temple
the home; offering rites that are open to the public should not be conducted in the At the very core of Wicca, the temple is the home. This is the bas view of community, that the largest of community is a collection of sm ties and that the smallest community is the family. But rites do not alw the home; offering rites that are open to the public should not be c home, lest the home be identified to the potentially baneful actions o Instead, a place large enough for the rite is established. If indoors ing the temple might involve renting a facility or maybe getting a per park. Should the rite be held outdoors, ensuring there is nothing for over is a good idea. Make sure there are no holes even if you were ce none yesterday. Remember that our furry critter friends sometimes w
Just prior to the rite, with guests now in attendance, either host, stands in the center of the area where the ritual will take place wit besoms in their hands. For added effect, small bells can be attached with bits of gravsl. roig fhe atho csinneedof a gooddw eeping . dosopeioitoyoua clockwise), the area is swept with the intent of cleansing. However, it fer ths breees te hit ths greuid er eevs aiy dirt at all. Ths idsa hsr iitsitiei ef clsaiiig ii yeur gusst’s eiid, iet te seil thsir fsst with d with bits ef gravsl. Se if ths arsa is ii issd ef a geed swsspiig, de gussts’ arrival aid thsi agaii syebelically eics thsy ars prsssit.
The acts of asperging (blessing with water) and smudging (blessing with smoke) are done with the intent of putting your guests in the right atmosphere for what will be
Asperging and Smudging
As with the lustral bath, one can use water that has been salted with sea salt for Ths acts ef aspsrgiig (blsssiig with watsr) aid seudgiig (blsss ars deis with ths iitsit ef puttiig yeur gussts ii ths right ateesphsrs takiig placs ii ths rits. As such, ths seudgiig aid aspsrgiig will cha As with ths lustral bath, eis cai uss watsr that has bssi saltsd aspsrgiig. Sees felk uss plaii watsr, but usiig ths givsi rscipss fer will werk wsll se leig as yeu uss a vsry wsak ceicsitratiei. That w aspsrgiig cai bs ussd te iiflusics yeur gussts tewards ths eattsr at clethiig wei’t bs staiisd ii yeur attsept te de se.
I havs sssi sees truly iivsitivs teels ussd fer ths aspsrgiig, but eaii ths haid er a braich ef weed sslsctsd ii accerdaics with ths i rite, keeping someone by the cauldron with that besom at hand is a great idea. Let your
Liber ab Nomen (Book of Name)
amount of water cast by e besom holder.
Smudging is most often accomplished with sage bundles called smudge sticks, which rite, keeping someone by the cauldron with that besom at hand is a gre guests know that if they dance by the cauldron, they will be cooled d amount of water cast by a besom holder.
Smudging is most often accomplished with sage bundles called smu
intent, there are specific recipes for incense that can be used to increase of that rite. Listed here are my two favorites for general smudging an
General Incense (1)
2 part Frankincense
Incense Recipes
General Incense (1)
2 part Frankincense
2 part Sandalwood
· 1 part Myrrh
· 2 parts Frankincense
An incense of choice for initiations, add enough frankincense or sandal
General Incense (2)
2 part Myrrh
Another good incenaeforimtiaWiond, add enough frankincense oil to bind.
Offering larcCrlrallenge and the Outsider Offering
The challenge has two parts. The first part of that challenge is to the folk who are in attendance. Although challenge sounds like an awfully scary term, it is simply that point
Offering the Challenge and the Outsider cast, it should not be broken. At a public rite, this might be the act of assuring folk that they can observe or theycanpariicipate,bolthat they fhoulddeoi dewhiehitistheyore atteidaice. Although challeige souids like ai awfully scaly telm, it is ii li,uti lliol ,o ,et htt,iii oi ,et Cilhit betlt i, it txlitiitd ,et, o htt,, i, teouid io, bt blokti. A, t lubiih li,t, ,eit miie, bt ,et th, oi t ,ety hti obttlvt ol ,ety hti ltl,ihilt,t, bu, ,et, ,ety teouid dthidt b ioiii ,o do lliol ,o ,et htt,iii oi ,et Cilhit. A, t btddiii, ,eit mii timiitl ,o ttkiii ii tvtlyoit llttti, hoitti,t ,o ,et mtllitit.
Ii t Wihhtiiii, ,eit it ,et th, oi ttkiii tvtlyoit ii t,,tidtiht ii , itb ltltoi ,o ,et hommuii,y. het ltltoi btiii Wihhtitd it tito li dtdiht,td ,o ,et, hommuii,y tid ttkiii ii ioik thhtl, eit ol etl dtdi habits come to mind. As Wicca is a path towards self improvement, many Wiccans have
32 A Wiccan Bible
affirmation that those things, the outsiders, are still aninflccnce івоие lives even though we have time and time again rejected them. By recognizing these demons, it is hoped habits come to mind. As Wicca is a path towards self improvement, ma taken to the inclusion of an outside offering or banishment within affirmation that those things, the outsiders, are still an influence in our l we have time and time again rejected them. By recognizing these de that we can then begin to remove them from our being.
The term ’Circle of Art’ has fallen from favor in the Wiccan community. It has been replaced with the shorter term ’Circle.’ I believe this has come about not out of simpli-Casting the Circle of Art word art tends to bring about pleasant thoughts. As art is the act of creation, and cre-The term ’Circle of Art’ has fallen from favor in the Wiccan comm replaced with the shorter term ’Circle.’ I believe this has come about n fication but because the masses are looking for something dark and word art tends to bring about pleasant thoughts. As art is the act of c ation is exactly what the Wiccan rites celebrate, I have chosen to agai
The casting of the Circle has many symbolic meanings. In the larg represents the Earth. In its smallest symbolism, it represents the sel between its largest symbolism and its smallest symbolism, it represen one’s state, one’s city, and one’s home. It is a boundary, a place where is separate from the outside world. It is often viewed as a place that is as if to say, this is where my concentration will be, here in this world th by casting the Circle.
Mother Earth througGhisbodysThkfemtle(Costess or ptiewtes.jshan doesthe samei only she points theathameioyheskyandvisualizesous LadyaiemgSe meet hesLosd’s tls mals (lost or prisst) will go to tls sast most part of tls ritual ar atlaes at tls gaauea aea visualizs aua haaa Fatlsa Skl asaelieg aa importance, but gehereriEspeaklnaWlccaconductiitsritasevilhthebarieV thatDark-ness comes befora Light, eafor tceauns wewillceploraiater,itise yaod SUao tiesitisa sebaaes. Bhtl bsgie ie tls Eaet aea yask eshekyies aahuea tls aitua eiaess seaiet ie tcs Eaet. I aa eat bssisvs tcs aaasa ie yciec tcie a iemaataees, bit tsesaasso emsaliet Wieea eaeaiete ite aitse yitc tcs esee eaese bssaas hitct, ea saa asaeaee ys yiss sxmsaas satsa, it ie a ta siaet eaetiet as tcs Ciaess bs aaes ta aaay im gatcsa Eaatc.
gion. Wiccans accept the fact that all life is sacred, including plant, animal, and human.
Inviting the Four Quarters
invitation at the Four Quarters is an affirmation that we draw on all of humanity to Wieeae aitias ieesiase ae ievitatiae ta tcs Faia Qiaatsae bseaies tiae. Wieeaee aeesmt tcs saet tcat ass siss ie eaeasa, ieesiaiet msaet, aei Bit it asea aseateizse tcat ys cavs bsse tivse a ieiqis maeitiae ie ievitatiae at tcs Faia Qiaatsae ie ae assiaeatiae tcat ys aaay ae as esst tcs aseaeae as tcat maeitiae. Bseaies cieaeito cae emasaa ta t
Facing East
Liber ab Nomen (Book of Name)
King, Shu, Duamutef, Neith, Indra, Long, Chung, Jtkoku, Raphael, Eurus, Vultumus, Dragon, and Eagle.
Facing East
’Before me I see my breath. Thee who has been called in times of ol
King, Shu, Duamutef, Neith, Indra, Long, Chung, Jikoku, Raph Vulturnus, Dragon, and Eagle.
Facing South
Before me do I see Jotunheimr and before me do I see Air. May tha my lungs with the breath of life breath life into this rite.’
Auster, Phoenix, and Elk. ’
Facing South
’Before me I see my spirit. Thee who has been called in times of o
King, Nut, Imset, Isis, Yama, Feng-huang, Hung, Komoku, Mich
Auster, Phoenix, and Elk.
Facing West
Before me do I see Muspellsheimr and before me do I see Fire. May
fills my spirit with flames bring fire into the spirit of this rite.’
Zephyrus, Favonius, Unicom, and Bear.
Facing West
’Before me I see my blood. Thee who has been called in times of
King, Tefnut, Kebechsenef, Selkhet, Varuna, Ch’i-lin, Hai, Zoch
Zephyrus, Favonius, Unicorn, and Bear.
Facing North
Before вігРєєп my Oodm.TdeewhohanbeencaHndin time ofoOd the Graen
King. GeP, flips Nephthye,Kubeeo, GuiXtan,Shoe, Binhamon,Aertel, Boeeas, Aquilo, Turtle, and Wolf.
Facing North
’Bnrecn mn I ynn my ieoy. Tinn pie iay innn callno in eimn er el ice. May that Khich infieibetothis rite aabohh that wemayatand proudinmue
Ate- ’
BnrecntmntoetItynntsirlonimctanotinrecntmntoetItynnteontricmamnnete icn.tMayteoaetpoicotiytricmtinteeteoiytcientaytieoyteoaetpntmaytyeanott
The invitation to our Lord and Lady is a positive affirmation that Wiccans do not see male superior to female or female superior to male. As with all words given here,
Invitation to our Lord and Lady
applicable to the rite itself.
The invitation to our Lord and Lady is a positive affirmation that see male suerior to female or female suerior to male As with all w see male superior to female or female superior to male. As with all w the lfiollbolwitngtihs jruistt aitn elfxample. Your words should come from yo appcae o e re se.
Here do I invoke that I may be whole
34 A Wiccan Bible
civ cmn, cody ccd soul
Here do I invoke that I may be whole
There love into
My mind, body and soul
For thou art the gods that were
Thou art the gods that will be
And thou art the gods that are
For thou art the gods of my father and mother
Thou art the gods of my sons and my daughters
And thou art the gods of my love and my self
For thou art my father and my mother
Thou art my sons and my daughters
And thou art my love and I
The symbolic Great Rite is an affirmation that Wicca views the Creator as both Lord and Lady. To be blunt, it is symbolic sex. The athame (masculine) is held over the chalice
The Symbolic Great Rite
is a visual reminder that Wiccans view the creation of life as the union of man and woman
The symbolic Great Rite is an affirmation that Wicca views the Crea and Lady. To be blunt, it is symbolic sex. The athame (masculine) is held (feminine) and then slowly lowered into the chalice as a symbolic act of s
i sa jtj-. rc Wta
Ae orc belovudLord ictoouhWelrvedLrly
r’a a stt so
Soismhtathamttathechahce
armaon-or- rr-ovr-o-rac-orr-s-mar.-sng-mrmrrs-o-thetselves-chules-th-hhld-haeds-mhr-this-hrtihe-hm-the-rite-is-thst-a tetseves-chupes-th-h-aes-hr-ts-phrthe-h-te-rte-s-thst-ap lhat union being all that has been created
As our beloved Lord is to our beloved Lady
So is the athame to the chalice
That union being the Creator
That union being all that has been created
That union being my love and I
this might be a time when a child is given presents by the members of the Circle. Should
The Body of the Ritual
of the Circle and introduced. In both cases, if the body of the ritual is a Wiccanmg, it is
The-bhdy-hm-the-ritual-is-that-which-is-beieg-celebrated.-Shhuld-this this-tight-be-a-tite-whee-a-child-is-givee-preseets-by-the-tetbers-hm-th it-be-the-Wiccaeieg-hm-ae-adult,-it-is-a-tite-whee-that-adult-is-brhught-hm-the-Circle-aed-ietrhduced.-Ie-bhth-cases,-im-the-bhdy-hm-the-ritual-is-a a-tite-whee-the-hhst-aed-hhstess-hm-that-Circle-give-a-eew-eate-th-th
Shhuld-the-reashe-mhr-the-rite-be-a-hhliday,-this-is-where-the-cel hhliday-ghes.-Shhuld-it-be-a-haedmastieg,-celebratihe-alsh-ghes-here.-A-beginning, middle, and end—birth, life, and death. Thus the body of the ritual, the
Liber ab Nomen (Book of Name)
Great Rite is the conception, the body of thentualis thmgrowtliol tlie maaickal child within the womb of the Circle, and the end of the ritual is the birth of the magickal beginning, middle, and end—birth, life, and death. Thus the body o magickal child that it produces, is marked after the symbolic Great Ri wGirtehaint Rthiteewisotmheb coofntcheeptCioirnc,letheanbdodtyheofetnhde oriftuthael irsittuhaelgirsotwhtehboifrtthh child. That magickal child is the product of the intent of the rite.
know what that intent is. Often, we become so concerned with using archetypes and
Stating Intent: The first half of the body of the ritual
counter productive to intent. Yes, it is possible to solicit the experience of a mystery
Although every Wiccan ritual has clear intent, many fall short of l know what that intent is. Often, we become so concerned with using hidden meaning that we forget hiding meaning from our guests is no counter productive to intent. Yes, it is possible to solicit the experie from a person by exposing them to influences that bring on that expe the intent of the rite, by all means continue to practice in that manne dynamics of raising group energy for a specific intent demands tha understand exactly what that intent is. So telling them to chant in som they do not understand will not be effective in causing the manifestatio child. If you doubt me, try this magickal chant taken from my Book of where it gets you: ’Ego similis nutrio asinius vomer.’
So instead of baffling guests, make the body of the ritual as clear tions. If you choose to use symbolism that may be missed by your guest maybe 800 guestgonnumber.Shecriedwithmrideas.he mumbledforth thatUer son was e preacher. While actinginruchn cenacity miohrnotsenmoverlyWiccaiorperch vbyeSg clbae eSobSo eScludb obcoSeqube ebbmeSgly ae muSdaSb ae epbb oor heeeo oemr my Rimlm Clooitec mioore eli l vesri olcr ih my trl mlytr 800 cireoe em mimtre. Sor ceers ieoo ceesr le eor mimttrs hi ile l cerlcore. Woetr lcoemc em eico l clclceoy mecoo mio errm ivrety ee creolemty imr ih oor mieo seerco ilye oi cimvry emormo. Atooiico mecooo esim lily hesim ooee eemctr orcomeqir, eo ee ctrle oolo oor lmcermo mrie le elcer.
Bikeh Hozho—hltr—Nieoo Amreecl
Pawnee creator anUikygmdwhNwar saidfoheveebeher oiftedoriaughriphechiu humanity.
Tirawa—hltr—Nieoo Amreecl
Pliirr uerloie lis ek\ cis ioi ile eles oi olvr reoore cehors ie o oimlieo\.
ity and the wealth that often accompanies the ability to read, write, and speak elegantly.
Ve—Male—Northern Europe
36 A Wiccan Bible
Waramurungundi—F emale—Australia
Ve—Male—Northern Europe
After Odin created Ask and Embla (the first of humanity), it was Ve who g
Raising Energy red RdMoing ImtentG
The Second HolIoO die Bodydf the Ritnal
Chances are you have heard the term ’Raising the Cone of Power.’ While it might
Raising Energy and Releasing Intent:
The Second Half of the Body of the Ritual
the universe with the hopes that it will manifest, than a group mind will be able to accomplish such a taskwithnven moreeftectinene ss.Theprincipleii the cooeoiWiccan tiued ratenr tpiiky, it it eiteiel mirn teae crnatitn titualizatiie i that human conscioiiseiesismegick,tI mthumee constioe sntpihastheabitttfte mani -ten ueitnntn cite ten eipnt teet it cill peeifntt, teee e lniup piee stimulate the mindiotm a thought. Thisiswhyee emil'in nolirtiScentSt woedSiand i itee props are used inoituaS——otOeeeuse theeeeeiois, іЄг“ііІп.\\огсКаеіІоіЄе“грпіре;рс magick in and of ttieresepreeii^u1:de^s.t^te thty pfimuiatefhehpman teind.Tliiyteitlie tone or mood in whichtheluman mind itmostlieiSuto tofo^^i^setipn^ncitilicittion.
If the intent ot mattii tethpeedoration of m.stcrie^ there m^hlnot bcaneidfot dncdt eni stii ie nitsetoect bidesti thcti dctcnt, tdiett, ccnit, eei
cussed later). Homeier, wheee aritemasanintentoihes thanOoemmoteoneteSmeeite itself, it is often Ік^іІиИо race eiicegclotl.lieSmirpeseentl tmcn teieleai eihaienieg0 Ic iti eeiiei cc iti neii et iti ixdtcneiece cc potiineitn itini pelti neeteel ieinlo. ctet pelti ti iti deti ee neisett tsdt et iti neii cc
child. This is calliut ie thitb ealottIytCmoI' ОієПірєоієіРпр mSheparSieieanttaoO then be released inip theuniveese.
ic iti seetinti. Ie iiideel ceit iti dneededti itei Wedde et e cinieteio ni iedi et itcslti ic ti iti dcedidiecen litieiecen eee tenitn cn nitietin dtete. ctet et detteel ce itei tiei cn ntoitp cc teci ic tcitt sd ee iti itie ti nitietie eeic iti seetinti.
fpr the raising pf the ce u eoSgiusie shortld OeclgeoanУ bringabiutfurthereonpeettd-dcei cc dccinn eee itinocei psti ccni ee toedtnceedeio. cti eeie
unethical treatmenialanimais,maybepgainstneedlattle Uorbaticki lliecpsicticet. dtiento tieiie eeiiei eee iti lsiti ccniie sd bo iti tieieel cc iti eeiie ccn iti neeteel cc iti dcei cc dccin ttcste bi dtien eee bneel ebcsi cs iece ce iti eeiiei. cti ccttcceel ccste bi eddncdneeii ee neeteel ie seiitedet inieipiei cc eeepettn peobi eleeeti eiietittto benbened iett
Earth, Air, Fire, Water
Give us strength
Start the chant slowly and quietly, and then build in speed and volume. As the chant
Liber ab Nomen (Book of Name) swelling up within them and then joining ter swirling mansol energy creaiteeby the other members of the Circle. That energy is seen as swirling around and up in the
Start the chant slowly and quietly, and then build in speed and volum grows, everyone in attendance visualizes the energy necessary to acco swelling up within them and then joining the swirling mass of energ other members of the Circle. That energy is seen as swirling aroun shape of a cone. A drumbeat is vital here, and best there be no less t mers in the center of the Circle. When the first person falls backward just cannot keep up with the chanting, the drummer who sees that per or her beat immediately and indicates as much to the other drummers. beat stops, everyone falls backwards, ends the chant, and launches th
A far less safe, but infinitely more effective method for raising a co have three Circles, one within the other. The innermost circle is drum wards. The outermost circle is chanters facing inwards. Between the t dancers. In this situation, should a dancer simply tire they move to the either join the chanters or take a break. Likewise, if a chanter deci dancer, he or she simply moves into the area where the dance takes p
The dancers serve two purposes, the first being that they are th energy. Their dance is the chant just as the drum beat is the chant, onl The reason this method is more dangerous is simple: It is more likely to of a person’s physical ability. Should the rite be for a specific purpose, a sudden release of the energy. So the safety net here might protect t hits the ground, dherersnOchantve alikeiThereteeyvisualizothwhoideOpnerecauheot-ing to the inteiidadtareni.Agaio,iwenitliattOis itttoZ thesalestpraclice.Whileitit the most effectivs,iCeou atlow dancegdtocontinut until somuonedropdoatltssSike-y restint. Wten ttat person tits tte tround, tte druccers sitnai tte st tits tte trouod, daocer aod ctaoter aiike. Ttere ttey visuaiize tte rais iot to tte ioteoded tartet. Ataio, I waro ttat ttis is oot tte saaest pra tte cost eaaective, ia you aiiow daocers to cootioue uotii soceooe dro ttat you wiii eocouoter epiieptic, dia.etic, aod core serious cedicai c tuests are prooe to ttose iiioesses.
Io a iess structured or teoerai rite, it is oateo uooecessary or icprac cooe oa power as a syoctrooous troup. As ao exacpie, io a pu.iic Sac eact persoo is asked to recec.er aod weicoce tteir departed ioved sicpiy woo’t do; towever, a troup settiot cittt. Here a daoce cao .e pose oa raisiot eoerty witt tte idea ttat tte daocers are stowiot ttei ooes ttat wtiie ttey do ciss ttec, ttey are tappy to .e aiive aod coov .y decoostratiot ttat ttey aeei tte .eat, ttat rtyttc oa iiae so stroot oo ctoice .ut to daoce to stow ttec. Io suct situatioos, wtat wiii ioev a aew aoik wto tave worked witt troups wiii tatter up otters wto tav
Raising Energy and its Relationship to Sex
Here, too, is the reason for sex magick as a sacred rite in tn e Wbcean religion. Now, please do not understand me to say that public rituals should include sex as a method of
Raising Energy and its Relationship to Sex
consenting adults, such activities are in the smallest of minorities within our commu-
Here, too, is the reason for sex magick as a sacred rite in the Wicca please do not understand me to say that public rituals should include se raising energy. Although Wicca in no way forbids such choices when consenting adults, such activities are in the smallest of minorities wit nity. Instead, please understand me to say that what is previously desc ing of energy is, itself, another symbolic Great Rite. In this instance, the when it is slow, coitus when it speeds, and simultaneous orgasm when or chanter falls out. So then, the actual act of sex is, in and of itself, s thus can include the raising of energy.
Should a couple make love with intent of exploring mysteries, in other’s soul, then like the raising of the cone of power in public ritual, be a need for a deliberate attempt to raise energy. However, if that lov have an intent, then the intent should be clear. The act of sexual un right, causes certain chemicals to be released into the blood stream dancing, chanting, and drumming. Those chemicals are similar in eff used in brainwashing and behavioral modification techniques. Inter similar drugs are sometimes used in conjunction with hypnosis for th pose of recalling suppressed memories. However, those practices h abandoned because rather than causing the recall of memories, the chant, and dance, theintent isrhatwhiuhss statod.hnthecwsu dflovemaking,theru is no difference othhrthan ifsemotecafuallucalleOeillowialk.Ploase understand t do ir shiughss. Si durhng lish tcsssshc rhsusl snd stx, iur ehnds ltciet saatas sl hlstls. Il sht asit lr aullha rhsusl sld taisssha isssti lthlg sa ahsls, sld dslat, sht hlstls hi shss whhah hi issstd. Il sht asit lr llvt ll dhrrtrtlat lshtr shsl hs hi elrt asiuslli aslltd ahlllw sslk. Pltsit lls drsw s lsrgt lhlt ltswttl rhsusl sld rtsl lhrt. Mskhlg llvt hi isartd asldlti sld hlatlit lurlhlg, sld sht elis healrssls slssr hl s esrrhs ltd.
Ir llvtri srt latl sl sht hdts lr uihlg itx sl rshit tltrgi rlr s au esli svtluti shss aluld lt txallrtd whsh sht wlrdi ialktl lr ahslst asl uit shtit arhlahalti sl lls llli rurshtr lur rtlsshllihhai lus sl lrh ssshll sht drtsei sld siahrsshlli lr shlit rtlsshllihhai.
tesy. However, it is a great deal more. It is an affirmation that we understand the prin
Thanking our Lord and Lady
potential, there could not be union—creation itself.
Thanking the Four Quarters
Liber ab Nomen (Book of Name)
attendance, but not banishing them as some suggest. Instead, they are thanked and
Thanking the Four Quarters
Typically this thanks comes in the form of thanking each of the Q attendance, but not banishing them as some suggest. Instead, they told that they may stay if they wish but go if they must. Your hospitali opened. I prefer it to be walked down with host and hostess holding hands and walking
Opening the Circle
Then they return, they hold up their hands so that all can see they are united, and
The Circle is either walked down in a counter-clockwise motion tohpeeCneirc.le pcoreunetrercloockewwisae freom oEwanstwto Easotsanadn theonsbeascsk too thnegcen Then they return, they hold up their hands so that all can see they Hostess: Merry do we part. u

Liber ab Genesis
(Book of Creation)
Ла, 7 &еяе (tty<="" p="">
Ла, t^i&ie ід my mtiat&i, udta ia atttety at favuidiac, Lo, I see here my fath
Lo, now I see all my deceased re
Lo, there is my master, who is sitti
,
—Norse Prayer recorded by Ahmed ibn Fadl the statement s origin. I had assumed for many years that it was attributed
^s—to a very close friend, but even she did not remember its origin. In prepara-cribbled in my Book of Shadows is a quote that once saved “Our creator is evidenced by our creativity.” There is no no the statement’s origin. I had assumed for many years that
мы-ajgg
Shakespeare or any of my other favorites. It was just some Joe trying to squeak out an
Liber ab Genesis (Book of Creation) thing someone made up. But isn t that whrtmytholngyis—boo andjtieceaoontiowl-edge that folk created in their effort to understand the nature of life such that they can
Shakespeare or any of my other favorites. It was just some Joe trying t existence by writing computer programs. The phrase that saved my l thing someone made up. But isn’t that what mythology is—bits and edge that folk created in their effort to understand the nature of life su exist within its confines? Sure, some mythology is incredibly old and so yesterday. But the test by which we determine if it is or is not sacred s age or lack thereof. The test is if it is empowering. That simple quote that I have never met saved my life, so it is sacred.
I was not there at the beginning of the world and will not pretend have not seen first hand. Neither was anyone else. I don’t know ho created, and I don’t know for a fact that its creator is evidenced by our works for me. Failing first-hand knowledge, we soothe our desire to the explanations that we can muster; we create what I call ’construct ing.’ These are the stories that help us to understand things that we science alone. In a way, they are magick because they give us the abili the nature of something whose nature has not yet been explained. In r of Genesis, it is important to understand that this is a construct for un
What follows is not sacred because it was written by a great prophe or goddess. It is sacred because I wrote it. Now before you think I am ous author you have ever encountered, note that I did not say it was sa interpret much os itliterahyorany oftt fundmmentahy. While fave pulledfeom on-cient lore spannino thmu sandsofye arepthe factts.madd rtfip.Tliet’sriikfttHook what I believe and madethesdontfit . wr’ytb.wlitly tak.l sapritmetraund like the ideal way of
If tictf seaay r bif sfrrace, baf I tede ftrf ae eae frkes ftis beek lnferdref tact ef lf llferrlll er rnl ef lf fandrtenfrlll. atlle I trve just cannot judge estoeybasrdonthedepayof theduntthrt hss mcecmnlate Tan d -
I belleve rnd trde fte sferl flf. New, wtlle ftrf tlctf nef seand llke ryyrtddlnc ntt lddat ef trtrnlen, ntt nrant ld nent ef ad wtrt nttrte Se w the creation storieaof majkr worldrahbione aaafoaedtheatmm.oaetcrejrtns Ьо.аЛ jadn trnnen jayct r dnerl brdty en ntt ytdnt ef ntt yadn ntrn trd rt Ntt er eoy, lf ln terkk ln terkk ray lf ln yetk aen terk ntta ln yetk ae find other people whorviievemuchtdktymr.Batthan tturnedonmytel exOrioncht and realized that antonaycantuotkvewithty ертоС iem.iteithetcfoaityoae elsm.Yoe oeek rn ml eta rtolclea ray nttrt s flay ntt drmt crdlac teot rcrl our own. Could aaerson b eeome me repomeod-tban to thiudchny hero aropreightoe flay tnter detdoe ttt beoleve matt nte drmee Ban ntea s naraey ta
A Creation Myth
“For tfia were a simple fact thaa msanity ic an exh, the sayingwould be true; but in reality the greatest of blessings come to us through madness,
A Creation Myth
“For if it were a simple fact that insanity is an evil, the saying would buht inirteiality tthe greaittest otfhblessdings come to us through madness, when it is sent as a gift of the gods.
From Socrates’ second speech, as recorded by Plato i crying brought on by perpetual loneliness, those tears going unnoticed because she is
In some versions of the Greek creation story, before there is Cha is Achlys (’dark mist’), who is the personification of misery. She is de woman with cheeks sunken from not eating. Her eyes are swollen and crying brought on by perpetual loneliness, those tears going unnotice alone in a way that none other could ever know. Think on that for which existed prior to even the void from which existence sprang is m
Call it misery, pain, loneliness, or whatever word describes the fe when one feels utterly alone—that feeling is a universal concept. N touch, to feel, to connect with another being brings on a very special fo mania of creation and destruction. A baby who is not touched will person who feels truly alone will take his or her life. This too is man destruction, Life and Death—it is the very principle that caused the French phrase for sexual orgasm, le petit mort, which means ’a little d her Mania but connected SnrOgdeata. TWe hhruscrns usedhWa worhmania astha name of the goddessofrWeUnderworld. The Fmaish used therootofahe wor dinShn name of their Undarrahrid, Mnnans.
psorinifyrdasnsrr,rcarringrtsoratsrGisssrrrMania.rTtsrancisnarRi hsorManiarbuarcinnscassrhsorairssaah.rThsrEaourcanrrurssrahsrsi nadsrifrahsrgisssrrrifrahsrUnssosiors.rThsrFinnirhrurssrahsroiiari nadsrifrahsiorUnssosiors,rManana.
Irhavsrraararins,rcirsransrhungoyrbuarsanaingrnsiahsorcidpaniinr niorfiis.rEiahsorsiursrinryrpoiringrahsrruffsoing.rIarsarrinrahaardid raiisrahsrniasrfoidrdyrBiikrifrShasisr:r“Ouorcosaaiorirrsvissncssrb Inrahaarinraanarifrdsdioy,rIrknssrahsrgisrrhasrniarfioraksnrds;rIrhas ThsyrhasrniargivsnrdsrsosadrrahaarIrhasrnirhipsrifrfurfirring.rInrahaar inrchiiringrLifs,rIrsarrosbion.rInrahaarosbioah,rIraouryrunssoraiisrahsrfio osrigiinransrahsrrscosarifrgsnsrir.rBuarbsfiosrIrcanrasrrryiurifrahaardyra danyrrscosar,ryiurdurarfiorarunssoraansrahsrnaauosrifrahsrsrsiosr,rdy
Arrscosarir,rridpry,rridsahingrahaarirrniarairs.rAnyahingrcanrbsrksp cissrfioryiuorATMrcaosrirrarrscosa.rInrarosrigiiurrcinasxa,rarrscosarirra piscsrifrinfiodaaiinrahaarsiahsorruppioarriorrsasrrinsrairunssoraansin irrinfiodaaiinriarcanrbsrsxchangss,rridsaidsrrsvsnrshsnriarrhiursrnia many gods and goddesses themselves. The secret is that we are not alone in our grief
Liber ab Genesis (Book of Creation)
many gods and goddesses themselves. The secret is that we are not a ggygy.
The Nameless One: A Creation in Sepa
Whose Holy Formula is ( -1 ) + 1 = 0
“The nameless is the origin of heaven and earth”
who was neither god nor man, neither male nor female. Because order had not yet
—From Ta night, nor hot and cold, nor life and death. The dark was darker than the absence of
In a time before time, in a place before places, there was only the who was neither god nor man, neither male nor female. Because or emerged from the Nameless One, there was no disorder. Neither wa night, nor hot and cold, nor life and death. The dark was darker tha light and the cold was colder than the absence of warmth.
The Nameless One was alone in a way that none before could have there were none before the Nameless One. The Nameless One was alo none since will ever know because there would never again be such would there be again anything darker than the absence of light, nor
Nameless One habnooeher w>lr.mtho go. The Nameless One had no lore, no faith with which to ease the suffering.Sothe NamelesrOnechosedegrh ina timewhenlhere was no death. It was tie llisl. aclmSlsweoniS thssacrtfice hramwhsh wa, hSisworid, eed al 1 dark place .Sere hesl ee us Sare rtstled Septeg eerer le relure. B wahalatt eea Sac ee elSar slaca le ge. hSa wahalatt eea Sac ee le
Darkness and Lchhhi ass. h'eeuilioii in Urnon
Whose Holy ForsaulaisliCl -12
From the division of the Nameless One by the first act of love and sacrifice came
Darkness and Light: A Creation in Union
Whose Holy Formula is ( -1 ) + 1 = 2
were the sum total of the universe, but neither was content knowing each was not whole without the other. Jusims the Nrmele ss Onefelhaianeforteerswai naotheieboth eeilS a steila see .Sesa eaha ts LtiSl aec a steila cadiSlai .Sesa ea Wtls lsati ciaaltee, lsa wahaiass eea .as ee heia. Fei a ltha, Lti .aia lsa sdh lelai ee lsa detraisa, edl eatlsai .as ceelael kee.tei aa .tlsedl lsa elsai. Jdsl as lsa wahaiass eea eail aieea eei lsaia .a
and Darkness discoverticfitst mattiay: WeareseparalsaforihessheoSceюh.
With that separation we see the nature of the Nameless One as the union of that
44 A Wiccan Bible
all forms of love. It is, in essence, the Fifth ElemeAt . Wiocnvariousey as Spirit, heart, and love, it is this force by which creation takes place in all orders. One of the manifes-
With that separation we see the nature of the Nameless One as t which is male and female. As a mystery, that observation is experientia aandolormves oit isotvheis. ftorsc,e nbyewssheincchec, rteaetionttakees mpleancte. innaollwonrdvearrso.Ousny tations of that Fifth Element is in the desire for sexual union. There we the Nameless One told in many lands by many cultures.
of masturbation.
Africa—The Egyptian Atum, was driven to unite in the same way as hi be: through sex. However, being all that existed, he had no one to e with. Egyptian lore thus records his creation of two children, Shu and of masturbation.
cited as sexual autonomy, thus leading to their separation and eventually to her reMiddle East—Before Eve, there was Adam’s first wife Lilith. Althoug Christian lore, she is still found in older accounts. Lilith (Darkness) an initially came into existence as conjoined twins. Lilith demanded auton cited as sexual autonomy, thus leading to their separation and even placement with the more passive Eve.
to be alone and to have a mate of her own.
Mediterranean—The Roman Diana is a name used to describe both D and Lucifer (Light) before their separation and then to refer to Diana separation. That separation came into play because Diana desperately w to be alone and to have a mate of her own.
more beloved than the two we would come to know as Earth and Sky. It is here that we
Sky and Earth: Children of Union
While Light and Darkness may have indeed caused life to start elsewhere, we have yet
From the union of our Light and Darkness came many children, n more beloved than the two we would come to know as Earth and Sky. find the story of the Wiccan religion begins. You see, Wicca is an Eart to meeet tghot saenbrotahrernseassndmasiystearvseInnsteeead cawuesesee oeutrocsrteaarttioenseswto many Nature-based religions that have come, before. As those many c they also looked back and attempted to explain the Nameless One.
Africa—The Egyptian Shu and Tefnut unite in the Great Rite. Lat birth to Geb (Earth) and Nut (Sky).
upper body and becomes the Sky and its Heavens, the sacred Yang. The lower portions China—The Chinese lore gives us the story of P’an Ku, who is also kn In the story of P’an Ku, the Nameless One is a cosmic egg that splits child or dwarf. As the child grows, the top half of the egg forms P’a upper body and becomes the Sky and its Heavens, the sacred Yang. Th of P’an Ku become the Earth and its oceans, the sacred Yin. In the stor Taoists, we see a similar separation of the male and female, which is and personified as Mu Gong and Yin in the West, personified as Hsi
New Zealand—The tribal folk of New Zealand, the Maori, offer a story similar to P’an
Liber ab Genesis (Book of Creation)
you are on. The Earth is Papi (female). Thecreationofosr worldis oresuhtf on) two being separated by their children, who are a product of their great love for each other,
New Zealand—The tribal folk of New Zealand, the Maori, offer a stor Ku. Here the Sky is Rangi or Raki (both male), depending on what p yboeuinagrseeopna.rateed byarttheirs chaipldr(eenmwaheo).are ea cprreoadtuocnt oof tohuerirwgorreat lsoav the Fifth Element.
Winter
Summer and Winter: Creation in Union and Separati
Light Half of the year Feminine
Summer
Winter
Sumcerand MiaSeu
Summer
honor of their grandparents. Winter, their son, was called the Dark half of the year in Summer and Winter
half of the year in honor of her Grandfather Light. It was their hope that by naming From the union of Earth and Sky came Winter and Summer who honor of their grandparents. Winter, their son, was called the Dark h honor of his Grandmother Darkness. Summer, their daughter, was n
ther Light, thoseaenof athensto cnmowouldiindGrstnddthet Llthouihl'emtnene, she would not exist witlo ut her mascutinehmlf.
undeostand that aethouth mascuelne, he woued not exlst wlthout hls f elke fafhlon, lt waf thelo hope that by namlnt thelo dauthteo Summeo a theo Lltht, thofe teneoatlonf to come woued undeoftand that aethou woued not exlft wlthout heo mafcuelne haef.
Heoe ataln we fee cuetuoe afteo cuetuoe attempt to expealn the fepaoated foo the fake of unlon.
the Earth. The world fell barren, and the first Winter began. Realizing what had hap-Mediterranean—The Goeek Peofephone waf kldnapped by Hadef an Undeowooed. Heo motheo, the feotlelty toddeff, Demeteo, mouoned h
Persephone tookvengeance onaNymphoameOMinthforOaving stoploilh Hades makes the story aeiEatehrerhPersephoneaooendtospendpartoftOeeear withher mother DemeterbocausztUefooed tor tfariyandthe othermortoBthe yestwithtSh one who had won herhemrt, Had es. Thus, Summer feturnedto the EartOwith
Peoferhore took iertearte or a Nyrrh raree Mlrth foo hailrt f rakef ehe feoOt a ble teeaOeO. PeOferhore atOeee eo frere raOe of e roeheO DereeeO betatfe fhe eoiee heO eeaOet are ehe oeheO raOe of e Near East—The Akkadian green man, Tammuz, presents the story of Persephone with
46 A Wiccan Bible
months were the ones to produce crops and the hot monilicwnrBibin as barren due to the intense sun. Each year he is taken to the Underworld by demons. Without his ferNear East—The Akkadian green man, Tammuz, presents the story of a reversal of both gender and climate. At the time and location of his months were the ones to produce crops and the hot months were seen the intense sun. Each year he is taken to the Underworld by demons. tility blessing the green of the Earth, the Summer begins. With his r cools and the green returns to the land. This story is virtually retold story of Damuzi.
Central and Northern Europe—When the Finnish Sampsa sleeps (sep Winter. When he awakes he is reunited (union) with his bride in Holy Summer returns. In the Autumn he again sleeps, and Winter returns. went looking for her, casting his rays and warming the soil as he did. Eventually she saw
North America—Onatha, the Iroquois personification of Spring and S napped by a demon and brought to the Underworld. There she re mother, Eithinoha, mourned her loss. As a result, fertility left the la went looking for her, casting his rays and warming the soil as he did. Ev the light and snuck up from the Underworld as the new wheat crop. Ev 1 he Creation oi the Nun

Light Half of the year
As children who are themselves parents often turn to their parents for advice, so did Sky and Earth turn to their mother Darkness for advice. In response to d with The Splitting of the Solar Year
Sun. Then she set both Earth and Sky rotating about the Sun such that they would see
As children who are themselves parents often turn to their paren did Sky and Earth turn to their mother Darkness for advice. In res permission from her Lord, Darkness took from her Lord enough Lig Sun. Then she set both Earth and Sky rotating about the Sun such tha
The First Order of Life—Plants:
Liber ab Genesis (B

The Quartering of the Solar Year
From the union of Winter and Summer did come forth many splendid and sacred things, many of which sunk roots deep into the darkness of the Earth hoping to unite The Quartering of the Solar Year
into the light and Sky hoping to unite with the masculine half of their line, Father and Grandfather. But neitfior remeunbonedtWatterren mystemridcoveoed solong ago,Spr while they did seeWsnterand Summer nnither weoepresentatthesnme limh.Tiyiih wieh ehe seeinine hels os eheir line, Moeher end Grendeoeher, es well ineo eee ligee end Sty eoring eo sniee wiee eee eescsline eels os eeeir Grendseeeer. Bse neieeer reeeebered eeee secred eyseery discovered weile eeey did see Wineer end Sseeer neieeer were rresene ee eee se eeey eigee, Wineer end Sseeer geve biree eo no ceildren eeee cosl sirse eyseery. And so were born eeny lines in eeis order os lise, bse n becoee ssccessssl. Inseeed, eee ceildren os Wineer end Sseeer qsi eleose seded eneirely.
mid of Winter and the lenenstdanaltSemid ol’Summos,
sells ee eee reet os eee Ligee eels os eee yeer. In eee eeere os Wineer (e ehe reet oS Dertness (Seeinine); in ehe heere oS Sseeer (Seeinine) oS Lishe (eescsline). ehss, ehe soler yeer, esein, is divided wieh ehe lon eid oS Wineer end ehe lonsese dey ee ehe eid oS Sseeer.
so did Sky and Earth turn to their parents for advice. This time they spoke with Light. In
The Creation of the Moon
to create the Moon. He then set the Moon about both Earth and Sky, so they would see Asein, es children who ere eheeselves rerenes oSeen esrn eo eheir r
The Second Order of Life—Animals
With Earth and Sky set spinning around the Sun, sodianhBsecend Great Rite of Earth and Sky take place. In that union was conceived all the animals that we have ever
The Second Order of Life—Animals
knowledge of the first mystery, that we are separated for the sake of union.
With Earth and Sky set spinning around the Sun, so did the secon Earth and Sky take place. In that union was conceived all the animals t known. Thus, the two lines became that of Plants and Animals, the diff knowledge of the first mystery, that we are separated for the sake of u
And so it came that the order brought forth by the union of Ea animals, were driven to both union and division in the way that Ear urnivteenatnoduonhonh.owe tnhgey rdivveindetod.wWaritshiunnnoontaimne atvaslloint,bteceamnee colea Earth and Sky (animals) would greatly dominate the line of Summer and
With so many wondrous lives found in both the first and second order of life who
The First Generation of Humanity—The Third Order
Between 169000 to 148000 B.C.E.—About 7000 generations a ,,
With so many wondrous lives found in both the first and second o would never know the full message of Sun and Moon, Earth and S although they indeed loved their children and their children’s childr assistance. So Earth and Sky created the third order of life—Humanit of all animals brought forth by the union of Sky and Earth and the plan saw three that stoommbrve the others, not looking down upon them but over them. These three were AsBeEaoieandCitron.
cided that they woold come from the first order of life, knowing thos body of a plan. tan know. Looking a. .hn many thildrnn of oommnr a saw .hrnn .ha. s.ood abovn .hn o.hnrs, no. looking down opon .hnm Thnsn .hrnn wnrn Ash, Elm, and Ci.ron.
Taking .hn .allns. of .hnsn thildrnn of oommnr and Win.nr whosn oky formnd i. in.o his imagn, .hn firs. man, in .hn imagn of all animals so did Ear.h .akn .hn sligh.ly shor.nr Elm and fashion i. in.o hnr imagn, in .hn imagn of all animals fnmaln. This trna.ion of .hosn who havn al .whans snooo.l .nha.. nisvdsiso.aintm.lyagmna, lbnoa.nnd .onn.omwaogmn a.na..hns ssooool..Fhao.r iosnd.ios.Hinot. .hing foond in .hn sntond ordnr of lifn bo. no. .hn firs..
made a present the fruit of that third tree, telling them as they offered it that this was
The Forbidden Fruit and the First Ascension of Hum
take it of their own will. For, in the eating of this fruit, they would become more than
This is .hn firs. astnnsion of homani.y. To .hn firs. man and woma madn a prnsnn. .hn froi. of .ha. .hird .rnn, .nlling .hnm as .hny offnrn .hn Forbiddnn Froi.—forbiddnn bntaosn i. is for homani.y alonn, bo. of birth, not one of union, but of separation. For, as surely as the child experiences the
Liber ab Genesis (Book of Creation)
if her own. And in this way, Ash and Elm errr^w thennffesingof otliors.Inthat.n) did Ash and Elm know the difference between right and wrong and so did they know sin.
of birth, not one of union, but of separation. For, as surely as the child pain of being made separate from its mother, so does the mother feel t if her own. And in this way, Ash and Elm knew the suffering of other Ash and Elm know the difference between right and wrong and so di For there is no sin in the tormenting of a mouse by a cat because the ca that it is wrong. Not knowing its pain, how could it? But humanity, th Ash and Elm, would never be able to so much as look at the cat torme without feeling the pain of the mouse.
So Ash and Elm knew they would not cause unneeded suffering bec suffer as well. They would not toy with a mouse, as does the cat, simp aware of the suffering incurred as the cat is unaware of the suffering others may well say that the eating of that fruit may have been origina hwuamsnaonti.tyTchoemematiitnsghoafvitnhge ffurlulikt nwoaws lneodtgseinth; asitnitisisthweroonngg.oSinogmaecctiaolnltah right and wrong, good and evil, a conscience.
spoke the word Father, and to Earth they spoke the word Mother. And so in respect
The First Praise of Our Lord and Lady
children, Mother Earth and Father Sky spoke, telling them that they were twice born.
And when these new creatures spoke, they spoke the new nam spoke the word Father, and to Earth they spoke the word Mother. A for our line, so do we also call to these as Sky Father and Earth M rise as do the planhsorthe Eorth,tEarwonldonedasdye.
Plants were born of Summer and Winter. Animals were born of Ear humonity wo. born of Summhr ono Winthr, o. A.h ono Elm, ono thhn ono Sdy, o. Humonity. To thhm thhy ol.o wornho thot whilh thhy woul ri.h o. oo thh plont. of thh Eorth, thhy woulo onh ooy oih.
That one day you will surely die
You were born of Summer and Winter
Then reborn of Earth and Sky
This is your blessing and your fate
That one day you will surely die
day of the year but before the first of Summer, there was a time in which the first It wo. not long bhforh thhir .tuoy of thh fir.t orohr of lifh founo thh thing.. Although it .hhmho ot fir.t on thh .urfoch thot plont. grhw in t thh yhor ono oiho ouring thh Dord Holf of thh yhor, it wo. clhor thot ooy of thh yhor but bhforh thh fir.t of Summhr, thhrh wo. o timh in .prout. hoo bhgun to brhod thhir .hhll. Thi. thhy collho thh fir.t Cro..
Longest Night of the Year
Fourth Cross Quarter,
[Masculine
First Cross Quarter
Longest Nigh
Winter
\Dark Half of th e year
Four
Summer
Third Cross Quarter Ligh
Longest Day of the Year
ss Quarte
Second. Cross Duarter
The Eight Spokes of the Solar Year
Being the first woman born under the Moon, Elm quickly discovered her cycles were different from that of the other orders of life. Where the females of other crea-
The Eight Spokes of the Solar Year
Like the womb of her beloved Earth Mother, her tides rose and fell with the Moon.
Being the first woman born under the Moon, Elm quickly disco were different from that of the other orders of life. Where the femal
Commenfaby on bheBEok Mf Czreation From this was observed the lunar calendar.
In Wicca, neither is the Creator male nor female, neither Lord nor Lady. Instead, Wicca views the Creator as the union of Lord and Lady. Our Lord is the masculine
Commentary on the Book of Creatio
the feminine principle of the soul (Yin) as well as the feminine principle of all things.
In Wicca, niithir is thi CriatOr mali nOr fimali, niithir LOrd nO Wicca viiis thi CriatOr as thi uniOn Of LOrd and Lady. Our LOrd principli Of thi sOul (Yang) as iill as thi masculini principli Of all thi thi fiminini principli Of thi sOul (Yin) as iill as thi fiminini princi
My viii Of Wicca strictly fOrbids thi naming Of thi CriatOr. Whili can bi fOund plainly in any Othir bOOk On Wicca, it is thiri fOr anyOni part Of thi viry fabric Of thi riligiOn Wicca is thi viii Of thi CriatOr a ShOuld Oni call thi CriatOr by Oni nami, ihativir that nami bi, Oni i ticing thi riligiOn that is Wicca. Whili thi iOrd ’fOrbid’ is nOt gini riligiOn, it is usid hiri fOr gOOd riasOn, but Only in thi sinsi that b nakid in a pOOl Of iatir fOrbids Oni frOm biing dry. Oni may aliays li bi dry and Oni may aliays liavi Wicca tO sii thi CriatOr in a iay Othir when that Nameless One is given a name, the sum total of all that which is sacred, all
Liber ab Genesis (Book of Creation) one looks at his neighbor s soul and seeediminisleedvaliie.oliatoctofnamin) the Creator is the very act that allows one to look at those who do not agree and say of when that Nameless One is given a name, the sum total of all that wh life, is devalued. This is the nature of things, that when one gives nam one looks at his neighbor’s soul and sees diminished value. That ac Creator is the very act that allows one to look at those who do not them ’They are all godless,’ or ’They are with a false god.’ It also crea idea that the Creator has an adversary or something apart from itself.
In giving the Creator the name Allah, one also names the adversa not followers of Allah, thus making it easy to take lives by saying the Allah. In giving the Creator the name Yahweh, one also names the adv are not followers of Yahweh, thus making it easy to take lives by sa without Yahweh. This principle was just as true on the eleventh day the year 2001 as it was at the beginning of the Crusades. So know then Creator is all these things—Allah, Yahweh, and all other names give ator. So many in fact, that that which is the sum of Creation can have
Forbidden in the same sense in my view of Wicca is the use of t refer to the Creator. Also forbidden is the word Goddess. For when ator God male, all who are female are devalued. Equally true is th creator Goddess female, all who are male are devalued.
So then in Wicca, the name God or Lord is the name of the mascu all things; the name Goddess or Lady is the name of the feminine princ
So then what odthi wasdCmeatarugidos thenamefoi the Cgeato r?In myviewo0 Wicca, the use ol'ths wordCr eatoritnotannmo forthoCrevtos. Itos bto olby wMoh is ot mtsculioe tspect tf the Cretttr withtut t btltociog femioioe ritovht Gvtttee, nv hvrt ritovht httr, tnt nv fttotr ritovht mvto
Sv totn rott vf tot rvrt Crtttvr hett te tot ntmt fvr tot Crtttv Wicct, tot het vf tot rvrt Crtttvr ie nvt t ntmt fvr tot Crtttvrd It i rt ctn cvmmhnicttt btsitf rito tovet rov otvt covetn tv givt tott Sovhst tot ptvpst vf ossto tek rott tvte t Wicctn rvreoip, tot Wicct

Тї" *11 її II її"
Liber ab 1 res 1
Liber ab T
Book of Potential and Fate
1^>гее d.dw y& ^diMdd—tfeiec Имел &dd dnd thnee Имел cpod dlcnc 23 ^ede the 'Wcccae
dfo Acdknitted, to foeea mdyd^ute 6y diddy "Jhufa&M “ Linet L Ltn Lin Ln^23 L Li Lwee2 rind2d 23&Ц mR d diGe nEgtm gaz ineubdtraedto
^umi my lm S&ddLrt

ne of the jokes about Wicca is that there are as many differentt2aditionsin Wicca as there are Wiccans. Although there is some truth Ft OhissSdinwnnt, there are a few documents that practically every Wiccan counts as sacred. The first of these to be discussed is the Wiccan Rede. No one can be 100 ne of the jokes about Wicca is that there are as many diffe Wicca as there are Wiccans. Although there is some truth t
there are a few documents that practically every Wiccan c The first of these to be discussed is the Wiccan Rede. No
loioc^ol^
f.
4 f.
term ’Rule of Three’ is as popular an expression as ’the Three Fold Law.’ The only real
Liber ab Tres I (Book of Three—Part I) the other we are told to always mind it unlessitesin ones selfdefense.—hestcond quote does not state that in self-defense the Rule of Three does not apply. It simply term ’Rule of Three’ is as popular an expression as ’the Three Fold La difference in the two quotes seems to be that in one we are told to alwa the other we are told to always mind it unless it is in one’s self defe quote does not state that in self-defense the Rule of Three does not says that the exception to always minding it is in matters of self-defen
I prefer the second quote, not because I received it before the fi without dismissing the Rule of Three, it tells us there are indeed times not stop and think, times when you should act instinctively, from the the mind or the Spirit (a combination of mind and soul). If one is clearl in one’s face, one simply does not have time to consider the ethical one’s actions. I find the second quote much more empowering to any themselves in a situation where such quick thinking is necessary. Yes, consider the ethics of becoming a soldier, but having made that decisi stop on the field of battle to decide if it is right to return fire. Yes, a consider the ethics of becoming a police officer, but having made that d police officer should not stop (as a fight begins) to decide if it is rig Yes, a Wiccan should consider the ethics behind actions in a life-threa but this should be conducted prior to the emergence of that life-threa So what is that rule of three?
· 1 Bide the Wiccan laws ye must, in perfect Tove andccafect teudt.
· 2 Ye must live and let to live, fairly take and fairly give.
(From my Book of Shadows)
· 1 Bide the Wiccan laws ye must in perfect love and perfect trus
· 2 Ye must live and let to live fairly take and fairly give.
· 3 Throw the circle thrice about to keep unwelcome spirits out.
· 4 To bind ye spell every time let ye spell be spake in rhyme.
· 5 Soft of eye light of touch speak ye little listen much.
· 6 Deosil go by the waxing moon chanting out the Witches Run
10 Heed the North wind’s mighty gale, lock the door and trim the sail.
7 Widdershins go by the waning moon, chanting out a baneful t
8 When the Lady’s moon is new kiss the hand to her times two 9 When the moon rides at her peak then your heart’s desire se 10 Heed the North wind’s mighty gale lock the door and trim th 11 When the wind comes from the South love will kiss thee on t 12 When the wind blows from the West departed souls will have 13 When the wind blows from the East expect the new and set t 17 When the Wheel has turned to Yule, light the log, let the Homed One rule.
18 Heed ye Flower, Bush and Tree, by the Lady, blessed be.
54 A Wiccan Bible
20 When ye have a true need, hearken not to others’ greed.
18 Heed ye Flower Bush and Tree by the Lady blessed be.
19 Where the rippling waters go cast a stone and truth you’ll kn
23 Less in thy own defense it be, always mind the Rule of Three.
20 When ye have a true need, hearken not to others’ greed.
24 When misfortune is enow, wear the blue star on thy brow.
· 21 Never a season with a fool shall ye spend, lest be counted as h
· 22 Merry meet and merry part bright the cheeks and warm the
· 23 Less in thy own defense it be always mind the Rule of Three.
· 24 When misfortune is enow, wear the blue star on thy brow.
· 25 True in Love ever be, lest thy lover’s false to thee.
· 26 These eight words the Wiccan Rede fulfill: An ye harm none, someone will send you thirty. For that matter, send me a hundred dollars, a thousand,
In line 23 of the Wiccan Rede is the instruction, perhaps a warning of Three. Some have taken the Rule of Three to mean that anythin return three-fold. If you believe this, I invite you to send me ten d someone will send you thirty. For that matter, send me a hundred dol ten thousand. Send me $333,333.33 and I promise I will return to yo that penny and the $999,999.99 that the universe magickally returns dance with that interpretation of the Rule of Three, you will be a millio that won’t actually happen because the universe does not follow laws who think they know better than Isaac Newton. Instead, the universe resented again annla^iN.InSte scicnceefthmemmld^amicnaAd stu dmof gravi tknoiid any form of enerkyegetcoesidern d byancientific method. No matter how much force
Called magicians in time tf tld and scientists ttdau, tnese are tne tne expsessitf tf Nrtuse’s lrg rftes disctvesifg it fts tnemselvesc Tne sesefted rgrif rfd rgrifc If tne sciefce tf tnesmrl dufrmics, tne stud rfu ftsm tf efesgu eves ctfsidesed tu r scieftific metntdc Nt mrttes utu put iftt tnstgifg rf ttject iftt tne ris, tnrt ttject gill ftt setus gitn rf equrl rmtuft tf efesgu, mucn less gitn tnsee times tnrt rm sntst, tne psevituslu meftitfed iftespsetrtitf tf tne Rule tf Tnsee is scieftific ttsesvrtitf tf tne lrg tf Nrtuse gtvesfifg rll ftsms tf mr Tne setusf is feves gsertes tnrf tne ifvestmeftc If it gese, gtsgifg p mrcnifes gtuld te ctmmtf plrce rfd I gtuld feves nrve tt pru rf e
Tne fumtes 3 is r mrgicgrl fumtes—ftt tecruse if ge mrge r g
Three is the Number of Humanity

The Number of Humanity
In the Book of Genesis, we saw three orders of life. This is not a new concept. In Brazil we see the description of the three orders of life reflected in the gods Jacy, The Number of Humanity
them body as he did. Guaracy created all the animals of the Earth, giving them both In the Book of Genesis, we saw three orders of life. This is not a
Brazil we see the description of the three orders of life reflected i Guaracy, and Peruda. Jacy is said to have created all the plants of t boedmy anod ysoausl aes he. didu.aPraecryudcraeacreeatead huemaannmcaonssociousenesasran,d nre,nSq”r0№man“ rrocmngOarmtoone іП/^Лош.іЛо
aont^at yn^mdntylye^gfn duoneesamudyly nom benefiUNtOeoT two. In abstract we also see this in the Greek Three Graces and The Horae.
All that one does will affect the mind, body, and soul; that these thr of humanity are inseparable; that causing harm to one will surely h other two and that causing benefit to one will surely cause benefit t two. In abstract we also see this in the Greek Three Graces and Th from the ash, became the first man. But it took other gods to finish the task: Lodehur to Norse Creators of Humanity—Male—North Europe
Name |
tw t (pnt) Em from the alh, became the |
, m t m, |
m t t w |
Odin |
g warmth and coloring |
— (k that of animall) and t |
nodO |
Lodehur |
Gave warmth and coloring |
Second order (animals) |
Soul |
Hoeni |
Name Gift Given |
Order of |
Life |
Lodehur Gave warmth and coloring Second order (animall)
Hoeni Gave realon Third order (humanity)
and merriment. With the rest of the Muses, they are the source of all inspiration.
Name |
Her name means |
Order of Life |
Association |
Thalia |
56 |
A Wiccan Bible |
Body |
Euphrosyne |
’She who rejoices the heart’ |
Second order (animals) |
Soul |
Aglaia |
Name Her name m |
eans Order of |
Life |
Euphrosyne ’She who rejoices the heart’ Second order (animals
Aglaia ’The brilliant’ Third order (humanity
found in the elder forest. The second brings the natural order and justice under the law of the wild (survival of the fittest). The third brings deliberate order, those laws written The Horae—Female—Mediterranean
Name |
Gift Siiven |
e. Ohi iicogt bragai ehi gOei |
Assoamtnan ioabirOei ortir, e |
Irene |
— be mOg. |
— First order (plants) |
Body |
Dike |
Natural law and Justice |
Second order (animals) |
Soul |
Eunomia |
Name Gift Give |
n Order of |
Life |
Dike Natural law and Justice Second order (animals)
Eunomia Deliberate Order Third order (humanity)
fortune as work product and the number that reminds us that there is creation in mania (inspiration). Not only did the Three Graces speak to our mind, body, and soul; as they
Three times good...
One, who can argue Odiehad eatgivmbintomania wdenheOuea fcomthotrewcalled Yggdrasil, The TesribteOnw’sHprse?The rereitobthatmanla wattheinepirehionfoc written language andthe maglckoSthe ninth.
eOhgiim, iwihlvoiicOOgriOrmaiiiiiOi,teihgihmOtiigioOeaiaievhiigyigipeooHmiOwgiOOi wohf iiggihpiirOheiiogag.frLoi
YaatrOial Ohi Oirrabli Ogi’i Horii? Ohi riiile of ehOe mOgaO wOi eh ’Early to bed and early tonaumakea manmaahHy,wealthy,and wise.’
San-xing— Name |
Oa—anerO iO |
Chanaia ao ’EOroe eo ba |
— gackandOaalth |
Lu-xing |
Honor and prosperity |
Shou-xing |
Name Fate/Asso |
Li-xaga Hogor Ogt proipiraee
Shoi-xaga Logaivaee Ogt waitom
< Fire of inspiration (patron of poetry and poets).
Brigit—FimOoi—CigerOo Eiropi
A Cioeac erapoi aottiii of agiparOeaog. Hir ehrii Oipic Three times bad...
Liber ab Tres I (Book of Three—Part I)
to distinguish between right and wrong, good and evil? There is a tremendous argu-
Three times bad...
in the existence of evil. If one were to redefine the word evil I might agree, but looking
Ah, remember that forbidden fruit, the citron which gave Ash an to distinguish between right and wrong, good and evil? There is a tr imnetnhteienxtihsteeWncieccoafnevciolmIfmounneitwy:eMreotsot raerdeevfeinrye qthueicwk otordsaeyvitlhIamtWihictcaa in my dictionary I have to believe evil does indeed exist in this world hearts of men.
· 1. Morally bad or wrong; wicked: an evil tyrant.
· 2. Causing ruin injury or pain; harmful: the evil effects of a poor
· 3. Characterized by or indicating future misfortune; ominous: ev
· 4. Bad or blameworthy by report; infamous: an evil reputation. tion of evil.
· 5. Characterized by anger or spite; malicious: an evil temper. 1
Now I do with all my heart believe Wicca is a religion but just argument let’s see if Wicca can be a religion without a belief in the d being day if there exists nothing that can be identified as night. So, if Wicca on o ev.
1. If there is nothing that is ’morally bad or wrong,’ then there is n is morally good or right. That is to say, one could not identify so being day if there exists nothing that can be identified as night. S
3. IfWicca does notb vhvi'ethat oncm іе,і, I'ncelLiluremіsfortuncawhawould
2. If Wicca does not acknowledge that one can cause ’ruin, injur in most versions oftheWiccan Rede: tWheretheLipplingwateiigo.cnst a stone and truth you’hknowc anWeee doe s welbwliwvem cvu,weare again nonsen3icaI. Ofcouete,wccauldbelheve thae whenwv dircovee she truth of the future, ailcopetvlViettake eiacwthervoregood.Bet inthat case, we would bej' esta liLtteCitoherie ootimiitidVevno tavtv .
4. If we do not thina. anvili'iyiciiit be ’bad о rHamewortliyay report,1 dowe igiti icisvistcili O. cctosv, ov cctle avltvrv reir oevi ov e rotre c. rev .trtov, all vrvirs rear rakv placv revov aov gccei casv, ov octle av jtsr a ltrrlv atr crvol’ cprtetsrtc .co e’ rasrv
4i I. ov ec icr retik ai’retig cai av ’aae co alaevocore’ a’ ovp icr sa’ retigs stce as cetle eclvsrartci aov aaet Sectle ov stce earrvost
5i Ae ea’av ov aov sa’tig rear aigvo aie sptrv ec icr vxtsri name for evil, any one personification because, like giving a name to the Nameless
Ii e’ rtvo c. otcca, ov cai sa’ ov srotrv icr rc pocecrv vrtli ov ec icr ocosetp vrtli Btr oear .clk aov ro’tig rc vxpovss ti sa’tig rear v ts rear Ertl (icrv rev captral E) ecvs icr vxtsri otccais ec icr ackic iaev .co vrtl, ai’ civ pvoscit.tcartci avcatsv, ltkv gtrtig a iaev r see that it is a number applied to the other side of the Rule of Three. Here we see three times bad...
The Three Sons of Carman—Male—Central Europe
see that it is a number applied to the other side of the Rule of Three H
The Three |
.. Sons of Carman— |
Dian |
Violenae |
Dother |
Evil |
Dub |
Name |
Dother Evil
Dub Darkness
called the Graiae. They were perhaps lesser known than the Gorgons were (the other set of triplets) but just as important. Each of the Graiae was born old, with gray hair
The Graiae—Female—Mediterranean
In Greek lore, two sets of triplets were born to Phorcys and Ceto. Th
calld G set of triplet |
aia. y w p s) but just as impo |
and only one taey controll |
toota and one eye |
ed tae fate given |
|
Enyo |
The Sister |
The Erinyes—Female—MediteiDannM
Three Greek goddesses born when Chronos killedHranon and the blood of Uranus fell on to the belly of his wife Gaia (also Uranus s mother).
The Erinye |
s—Female—Mediter |
laree Gree |
k goddesses born w |
fell on to ta |
e belly of ais wife Ga |
Tisiphone |
Name A |
Megaera Jealo
The second set of triplets born to Phorcys and Ceto.
Attribute n—Female—Mediter |
|
The Gorgo lae secon |
t f tilt b t |
Euryale |
Far Roaming |
Sthenno |
Name A |
The Harpies—Female—Mediterranean
Liber ab Tres I (Book of Three—Part I) right and wrong, here we see the face of each. Initially, the Harpies were depicted as beautiful winged maidens, perhaps virgins. They were set about the world to insure
The Harpies—Female—Mediterranean
Here we see not only evidence that the ancient Greeks saw a clear dif
beautiful winged |
aidens, perhaps virgins. T |
that peace and law of the world they |
fulness prevailed. But when became hideous. |
Celaeno |
The Dark |
Na |
me Attribute |
COecyapeentoe Swieft Waring
Three is the number of fate. This is not a fate that is predetermined by a supernatural force. Three is the number the fate that we choose. We are each born, and we will
Three is the Number of Fate
number that speaks to the whole of that which we are without the limitation of time. It
Three is the number of fate. This is not a fate that is predetermined ral force. Three is the number the fate that we choose. We are each b each die. Three is the number of these two points and all that is in th
Past |
s the sum tot |
l, our begi |
Mind t |
biemweshethnrewee’ aw |
rheicnhoilsotnhge |
Body |
Body |
|
Soul |
Soul |
Soul |
Mind Mind Mind ddd
That which will be
That which has been
That which is
That 1 Moment


The Moment
The idea that any one moment in a person’s life is a dance between the past, present,
60 A Wiccan Bible
middle, and an end. However, from the viewpoint A thatmomentwe just spoke of, the future is seen as changing because it has not yet taken place.
e ea tat any one moment n a persons e s a ance etween and future is not a new concept. Nor is the idea that all things hav middle and an end. However from the viewpoint of that moment we j future is seen as changing because it has not yet taken place.
seen as the more common Wiccan pledge ’A year and a day or for as long as love shall The Three Fates (Also known as The Moirae)—Female—Mediterran
Goddess |
pweeab\. C |
abbfgg ehep |
ew bbe\\ a hag\fa |
\efgg \hwr\ ee\pece fwe gaeuea |
Clotho |
\eeg a\ ehe |
pwee cwp |
wg gfccag pbe\ |
ge ’l yeae ag\ a \ay we fwe a\ |
Lachesis |
Opportunity |
Present |
Transitional |
Presents opportunity |
Atropos |
Goddess |
State |
Teese |
Coeditioe Descriptio |
Lachesis Opportunity Present Transitional Presents o
sound very Wiccan, especially not when we make such an objection to a great record
Atropos Conclusion Future Changing She who c
opportunities that are presented during our lifetimes, we see that we show Atropos
The thought of having an outside force cut your thread does not sound very Wiccan, especially not when we make such an objection t keeper in the sky. But when we recognize the potential with which we opportunities that are presented during our lifetimes we see that w things that have exme,areheee,and wuUl eomaWe see the development of the Triple goddess as associated with past, present, and future as well as an association to the
Carmentis Sisters—Female—Medieeeeanean
Goddess |
ehfgg\ ehae have cwpe, |
aee heee, ag\ rfbb |
cwpe. ge \ee ehe \evebwpp |
Postvorta |
gw\\e\\ a\ a\\wcfaee\ |
rfeh pa\e, pee\ege |
ag\ fueuee a\ rebb a\ ag a |
Carmenta |
ugchaggfgg ag\ chagg |
gg. |
Transitional |
Porrima |
Goddess St |
ate |
Teese Coedit |
Caemenea Oppweeuniey Peesene Teansie
Female—North Europe
Pweeima Cwnclusiwn Fueuee Changi
with three aspects: Urd, Verdani, and Skuld. Other times, the principle is seen as three entirely separate godNesses oAwoicaWyvdesvneethgothergwobeinWVerdaniend Female—Nweeh Euewpe
the present, foreverweaviwg t.hv fpbtiGeffhe awfu\e. Skuldrepresentedhe fudare niui rieh eheee aipecei: Ue\, Vee\ani, an\ Skul\. Oehee eimei, ehe peincipl
Goddess |
State |
Tense |
Condition |
Urd |
Lib |
er ab Tres I (B |
ook of Three—Part I) |
Verdani |
Opportunity |
Present |
Transitional |
Skuld |
Goddess St |
ate |
Tense Condit |
Verdani Opportunity Present T
The Promise of Our Lady Ishtar
Here do I invoke that I may be whole
The Promise of Our Lady Ishtar
Three is the number of Wiccan Self-Dedication. It is the number of our Lord, our
Here do I invoke that I may be whole
Their love into my mind, body, and soul
and adult rites of other religions where the dedicant is said to be absolved of sin. When
Three is the number of Wiccan Self-Dedication. It is the number
Lady, and their children, us. When one dedicates oneself to Wicca, Lord and Lady into the mind, body, and soul. This invitation replaces th and adult rites of other religions where the dedicant is said to be absol one dedicates oneself to Wicca, one’s sins are not removed, they are a
The act of dedicating oneself to Wicca is the act of declaring to o
Indeed, it is oftenpomobie fotunjustsctiond thetb tinnsoneto Wieca.Upons eeinfOha Satan or boogieman controlling one’s actions. It is an acceptance of th tists we iave dote, are dosts, atd wsll do affectt our mstd, body, atd formula tiat st tiree tsmet tiree. Tist st tot to tay tiat Wsccatt do t Itdeed, st st oftet remorte for utjutt actsott tiat brstst ote to Wscca. cartase brousit ot iumatsty at a retult of ier wordt before tie atte
Upoa my neck/ shall -too ieork^t, twore to tie sodt upot ier lapst tiat tie would tever asast act to ms
’Ye gods here, as surely as this lapis Upon my neck I shall -not forget, I shall be mindful of these days, forgetting never.
Ishtar speaking of the
From the Gilga
Wiccan speak of such excuses and remain true to the Rule of Three:
sreat caomeftoort mst tbeastes; ledt stt bteostsa abale toobtleamt eotuomecootoeteeltesfor oet Tist st tie tature of Alestter Crowley’t ttatemett; ’Tie tlavet tiall te lust admit it.
J
’It wasn’t me. It was the [insert drug or alcohol of choice]. ’—Who put that
62 A Wiccan Bible
Wiccans refuse to be slaves to Satan, the boogieman, or any other excuse. We are ’It wasn’t me. It was the [insert drug or alcohol of choice].’—Who alcohol into your mouth? If it wasn’t you, then where is the police r what is right and what is wrong. In this, I do not mean what is right and wrong just for
Wiccans refuse to be slaves to Satan, the boogieman, or any other not sheep. If you are a slave, sheep, or any other colloquialism deno then Wicca is not the religion for you. You see, in Wicca, you must de what is right and what is wrong. In this, I do not mean what is right an yourself, but what is right and wrong in the totality of the terms. To must decide what is good, what is evil, and then look inside oneself, and take action to remove that which is evil. Wicca is a religion in wh improve oneself.
In this I have seen the downfall of many that have come to Wicc reasons. If one becomes Wiccan and does not recognize the need to id evil within ones self, there is no moral authority as guidance. No one to one’s actions are right or wrong. Consider the abortion issue, in Wicca lic Church. Most Catholics will tell you that the Church finds abortio great, it is punishable by excommunication. Most Wiccans will tell you religion is pro-choice. Note that the Catholic Church addresses the i but Wiccans tend in conversation to address only the political stance o abortion. What benefit is Wicca to a person considering abortion if she to do that which Wicca insists? That is, to consult one’s own soul an
believe should bbWicunnoWhilesfch mattersarngotbpsthecidedbysomtgtoep of
Now, I know I just pressed a few buttons by using the abortion issu pispli infift thst thi iffti if nst s msttir sc riligisn. Thsfi cslk lik sbsrtisn if s pirfsnsl chsici, nst s riligistf ieict. Thsfi cslk sri ixsc biliivi fhstle bi Wiccsn. Whili ftch msttirf sri nst bift eicieie b your soul and found thftii isnot a wrongdentsionfonyoUiShenitssnot an immoeafanS. swn priift/iff, msking eicifisnf minectl sc right sne wrsng, thin hsv having or not haviitc anab ortieoitnntnmafiec о fmoral itg.SnWicca, motaliteostS'thc highest order. ThatorOer ic smornlity іnotInyhtheinaiitgntii musn decideSo short ic tbt what is right and whotis wsnego
Htngtgoa et ntt thank thSt at hSf nt ctnfgqtgncga Sne et ntt thank hstany to ntt hstany sn sbtotatn af ntt s osttgo tc otos.atb. In Waccsa hayhgft toego. Thst toego af s otos.atb an nhach thg aneataets. otft e sociopaths are genosahy iyttitutionolitefnoonthat someone else makes decisions for
Tskg afftg nath thaf sf btt na... Wath to nathttt btto syoggognta thst an tto ftcagtba csa.any thg sba.atb tt kntn thg eaccgogncg bgtnggn ngystgf s ogoftn’f sba.atb tt osotacaostg an thg .gys. fbftgo. In tto f ftcatosthf sog ygngos..b anftatttatns.azge ftch thst ftogtng g.fg os heart. Do not make an honest attempt to listen to that source and you can be just as
Liber ab Tres I (Book of ThreePart I) the Ku Klux Klan.
heart. Do not make an honest attempt to listen to that source and yo much a member of Wicca as an African-American Jewish lesbian can the Ku Klux Klan.
Three is the Number of Hope and of Afterthought
Three is the Number of the Outside
I bind your ways
Three is the Number of Hope and of Aftertho
I end your days
I draw you up
I bind your ways
I cast you out
I end your days
wish we could rid ourselves of. Each year at the Real Witches Ball, I host a simply huge
—A simple chant to banish the Ou Sometimes we come around the Circle with a box in which to place them, other times I The Outsiders are those baneful things within each and every o wish we could rid ourselves of. Each year at the Real Witches Ball, I ho Samhain Rite in which everyone in attendance is asked to fork over Sometimes we come around the Circle with a box in which to place the arrived at perfection, what puapo pedoesorelikiupspptbserve?
toss it out of the Circle. Each year about half the folk look on as if in which the Circleistobe case. The hepehs thattheOutsiderswill Inaveilteriiual
is ionfusing as if to say ’Wto m,? No, I am p,rf,it ttank you.’ If arrIvet al perfeilIoi, wtal purpose toes a relIeIous palt serve?
If ai offerIie Is eate, lte Itea Is ltal ai appeaseeeil Is eate oul Ii wtIit lte CIrile Is lo be iasl. bte tope Is ltal lte OulsIters wIll spaie lo reieIve lte appeaseeeil. If baiIstIie lte OulsIters, ey pr lte OulsIters are iolleilet froe everyoie Ii alleitaiie ait ltei eIl reeovet froe lte iIrile. Ai exielleil way lo syebolIially iolleil lt wIlt a Paitora’s Box. Per Greek lore, Zeus puiIstet tueaiIly for fIre (syebolIi of MIit) froe Proeelteus, wto tat slolei Il froe lte of ltal puiIsteeil was lo uiIle Paitora, wtose iaee eeais ’ EpIeelteus, wtose iaee eeais ’afler ltouetl.’ WIlt Paitora iae was lolt iol lo opei uiter aiy iIriueslaiie. Ste eave Ii lo iurIosIly box. Froe wIltIi iaee all lte evIls of lte worlt. Ste quIikly slaee topIie lo preveil furlter release, bul by lte lIee ste eol Il stul lte ltIie reeaIiIie—tope. btree Is lte iueber of Paitora, EpIeel eaeIikal itIlt, lte OulsIters.
view of Wiccan ritual incorporates an offering to or banishing of the Outsiders prior to
64 A Wiccan Bible
takes place with every Wiccan ritual, it is of evengweeicrimportance during a SelfDedication rite.
view of Wiccan ritual incorporates an offering to or banishing of the O the casting or closing of the circle. Although this portion of the Wicca takes place with every Wiccan ritual, it is of even greater importanc Dedication rite.
Three is the number of who we are. It is the number that says that while we embrace our Father above and Mother below, we are ourselves at center. Although we
Three is the Number of Who We A who and what we are is found in the trunk, our own individual mind, body, and soul in
Three is the number of who we are. It is the number that says th brace our Father above and Mother below, we are ourselves at cent have branches reaching into the sky and roots stretching into the Ea who and what we are is found in the trunk, our own individual mind, b the past, present and future. Although there is very little written ma prove the ancient Druids saw the Principle of Three represented in and branches of the tree; there is certainly a lot of modern Druid liter this view was held by the ancient Druids. Finally, three is also the nu religion of not only old and new, but also of balancing the ancient an the needs of its followers.
both lived and died, demonstrated:
Chapter Dedicati
This chapter is dedicated in loving memory of my f And the wisdom to know the difference.3
Liber ab Exodus
(Book of Departure)
Our Separation Began
(Book of Departu
але the M fteo-fete We one t^ie (tew fteofele We one t&e &wte fteofele
We are We are We are Some w
We one tke &Wte WOlft
We are
We are We are Some w
We one tke eame c^le
We are We are We are
л*.;.**.]
65
fn June 26 2002, a 73-year-old widow, grandmother, and Cherokee, by the
66 A Wiccan Bible
of her ancestors in Newark, Ohio, a site wherechan adgoeie to pray for over 20 years. That sacred site is the worlds largest—note: I did not say one of, but
n June 26 2002, a 73-year-old widow, grandmother, and C name of Barbara Crandell, was arrested while praying, sittin of her ancestors in Newark, Ohio, a site where she had gone 20 years. That sacred site is the worlds largest—note: I did no the world’s largest—earthworks. In reference to its world sig been called the Stonehenge of America. Various attempts to date it ha age of between 2,000 and 5,000 years of age. Described as a problem w the history of North America, the Octagonal Earthworks of Newark, originally built by the Cherokee. Certainly the Cherokee adopted it a cred ground long before those who currently use it, but the truth is tha cannot be 100-percent sure who built it.
Although she had with her a copy of the lease that grants the curre sion to use the site only if they keep it open to the public at all times, t using that land seem to think that all times means the four days of t the site is open to the public. But that fact did not impede her taunti
2002, describing Barbara Crandell, written by Barbara Carmen)
“They cuffed her hands behind her back and ordered her up. When couldn’t rise, she said, they dragged her to her feet. Snapshots show fingerprints down her bruised arms.” (From The Columbus Dispat 2002, describing Barbara Crandell, written by Barbara Carmen) crime really so horrible that the police could not wait until she was done praying before they inflicted her brHises?Despita theledterofthelwaseanUthc statementsbmthe Ohio Historical SocietyfoundinUteraturaandtheirWebsieefoverandoeeragamtha3 the Octagon Earthwoeaseeeopenueeereued,Barbaso tdu ііЄєГіііarlnieilgiiiityol’ trespassing. The Ohio HittoiiselSocietydeclinecIcommsritorirhw verOictS
eouy ioflieeue our aruisus? Dustieu eou lueeur lf eou luesu eoe eou se soil Hiielrieet Sleiuey fluoe io tieureeuru eoe eouir Wuaiieui ltur eo eou seeeglo Eereoslrki eru ltuo yuer rluoe, Beraere creoeutt sei eruiteiiiog. Tou soil Hiielrieet Sleiuey euetioue elttuoe lo eou tu
Sl soee ii eoii Eigoeo Meo-Meeu Wloeur lf eou Wlrte eurruoety iziog eou iieu oee gruee iigoifieeoe tueoiog, ie sei tureoeiue sieo 1893. Etuoeuetty ie sei tueiue el e eluoery etua, soieo eie ole iie tury fltk, il eou teeeur eetu auflru eou elurei lf soil sol rutue eoee auee sei lf iueo iigoifieeoe oiielrie tetuu, eoee ie au euueue el eou soil Hi Wieo soee iuuti tiku tury quuieiloeatu siielt, eou soil Hiie tueiue eou teoe aeek el eou eluoery etua uoeit eou yuer 20a8. Woitu lou soil Hiielrie Sleiuey oee eou flrueolugoe lf truiurtiog eou iieu eoe ku eou tuatie, gruee etluoei lf eetegu oetu ols auuo elou el eou teo ctuai ufflrei el teioeeio eoe uxteoe eouir iteeilui gltf eluriu.
Sl soy eie iltulou oeoeeuff, ereg, eoe aruiiu e a3-yuer-lte sielsu
According to Barbara, prior to her arrest she was taunted, ’Haven’t you people got
Liber ab Exodus (Book of Departure)
According to Barbara, prior to her arrest she was taunted, ’Haven’ anything better to do?’ My gods, our gods, who are these ’you people’ If all of current humanity began with only one mother, how is it that we look so different? Do we each not have two feet, two hands, two eyes? And what of race? If we
Our Story Begins in Africa
In this matter, better questions are: Do we look all that different? Are there mul-
If all of current humanity began with only one mother, how is it different? Do we each not have two feet, two hands, two eyes? And wh were all born of one mother, why is it there are different races of hum
In this matter, better questions are: Do we look all that different? tiple races of humanity? The answer to both is a resounding no. In fac bers of humanity are about as closely related as two can be without person. In the vastness of the human race, there are no two human further apart then two members of even the smallest community of That is to say, if you take a tall black man with brown eyes and a sho with blue eyes, the amount of genetic diversity between the two is less of genetic diversity found within any one pack of wolves. There is o humanity, that being the human race. As such, in my view of Wicca, t one Mother and only one Father.
Of the few differences seen within that race, few can be attribu other than sexual selection. Skin color is an example. You may have exposure to ultracioletradiatios, ouk sOincanhoVoroduee vikamin D.Withouimitami n darker skin. This is because skin pigment is humanity’s way of protect geeius ulieaviilei ealiaiiin. Daek skin inhibiis ihe absiepiiin in ihe ieua in sunlighi like a naiueal sun ian liiiin. Hiwevee, in we li nii expisuee ii ulieaviilei ealiaiiin, iue skin cannii peiluce viiaain D. rica is great, therei s Wittlecoopercorworhyabs utvitaminD StI'icinocyot tine eeolop-all line began, laek skin aeans a healihy bily because ii peevenis in petielly tuenel ty ihti ulietviilei etlitiiini eesuliine in hieeitle li ii ctnceeius eeiwihs. Bectuse ihe taiuni in ulietviilei liehi sieikine eict is eeetii iheee is liiile cinceen ie wieey ttiui viitain e leniciency aeni in eickeis even in ine hts ihe ltekesi in skin. Bui ts ine aive iniense ulietviilei etlitiiini ltek skin pieaenitiiin ctuses ine ii sun e leniciencies tnl teciae hieeitly lisnieueel lue ii eickeis. The ntci nilk whi tee hieeitly lisnieueel li nii ienl ii teeel ts inien ts n hieeitly lisnieueel. This itseevtiiin is ctllel sexutl seleciiin. While wty in which we evilvei ii is ceeitinly t atjie cinieituiie.
As we aieetiel twty neia ihe tieihpltce in Ash tnl Elai we ch ihiuehi iui ie leliteetie tiieapi ii tltpi ii iue envieinaenii tui in ine tiieapi ii seleci ihe tesi pissitle eenes nie iue chilleen. i hes deficiency. The end result of that process was the appearance of white folk, black folk,
68 A Wiccan Bible
In my view of Wicca, we state firmly that all humans are the children of the one Mother Earth and Father Sky for two reasons. One’s mother, no matter what she might deficiency. The end result of that process was the appearance of white and a variety of folk between black and white, all with the same moth
In my view of Wicca, we state firmly that all humans are the chi Mother Earth and Father Sky for two reasons. One’s mother, no matte tell you, is still one’s mother no matter who one chooses to have sex wi more or less scientific fact that all humanity has a genetic link to one w in Africa.
The great religions and sciences of the world have been wrong. mention of Eden where for a time lived Adam and Eve in your Christi Maybe you were raised in Islam where you read about Adan where Adam and Haiwa. Well, each of these world religions was wrong and
Science seems to have come to replace religion. You might hav Lucy and perhaps of the ’Scopes Monkey Trial’ (State v. John Scopes) That information is wrong as well. In fact, although folk seem to think t won his case, he in fact lost. Later it was overturned, but never won. T the thing made a monkey out of the courts so they dropped it because t be gained by punishing Mr. Scopes.
That was then and this is now. Today, recognizing the fact that even the science of past generations were wrong is critical. In the past, cal, chemical, and other weapons had not been invented. Folk could
Asia and then evwlvch inlomn dernhumanity.
tion on a global scale. It was more or less globally safe to perpetuate cuiieit coicept of evolutioi. That myth ii that Lucy (ape-like aiceito aid wai the piedeceiioi to the waideiiig Homo Eiectui who moved Aiia aid thei evolved iito modeii humaiity.
The gieat ieligioii aid icieice of the woild have beei iight. Wha juit iay that both icieice aid ieligioi had beei wioig? Why, yei I di ioticiig. Religioii have beei iight ii itatiig that humaiity emeiged ai juit that, humaiity, oi modeii mai. Scieice ii piobably iight ii ita ity evolved, but it wai wioig ii the idea that we left Afiica ai aiyt modeii humaii. Oh, maybe iome diitait couiiii did leave Afiica, bu tioi thoie couiiii died.
My view of Wicca (aid I hope youii) ii that Wicca ii a liviig iel with the timei, acceptiig iew icieice aid diiiegaidiig the miitakei the pait. So wheie we oice felt theie weie ’iacei’ of humaiity, toda that we aie oie iace, oie people —iot becauie it ii politically coiiect, veiy iuivival demaidi it. Now that we have the ability to deitioy oui w ovei, we muit giow ii uideiitaidiig iuch that we do maiifeit that po ity. Ii othei woidi, we muit evolve oi we will become extiict.
being? Again, do we hold a funeral every time a woman menstruates? After all, the
Liber ab Exodus (Book of Departure) pregnant. Maybe we did evolve in the womr olAlrioohut weooerodfropi thut wrnnb just as human as any human child emerges from his or her mother. We are one people.
being? Again, do we hold a funeral every time a woman menstruate great majority of miscarriages occur without the woman’s knowledg pregnant. Maybe we did evolve in the womb of Africa but we emerged just as human as any human child emerges from his or her mother. We
Today, science has a wonderful new tool called DNA by which to Within the makeup of each and every human being is something calle DNA. It is found in virtually every cell in the human body but it is n normal chromosomal DNA. Of the more than three billion base pairs only about 16,500 are mitochondrial. The other more than 99.99 per the chromosomes. Unlike chromosomal DNA, only the mother passe DNA. Because it is separate from the typical chromosomal DNA, it trace genetic lineage all the way back to one woman who lived in Afri cheild orogcraonndchriald ofveA, ssh eansdnEolm. IenstemadspMo iteoochonndrieal Ersvec thape Ee ern religions lived approximately 2200 generations after Ash and dren, who left to the four corners of their garden Africa. These were the first modern ocaon one on e map on page , wc s were our sory egns.
In or around what we now call the Congo, Ash and Elm were born 148,000 bce, or about 7,000 generations ago. From Ash and Elm did dren, who left to the four corners of their garden Africa. These were humans, not at all unlike you and I. They were hunter-gatherers, nego to the east they couldanddidpasu.Theirl'i гьУ attempts tOexouue broughtthrm to the east shore of the RedSeewhsoe they fohowed the coajtlinenorth,passingthe Valley of the Kings and crotssngdhrooge Gmeaintothe Middle Oast asfaraiGclileeacd maybe o bit furtOer. detahmt iswhere tliitSitsrexodists'oulcleitd.Tlieiiert atremmt would not be for thousenOsof yaarti
The Fu st Exodytse Maos ІоусаГвот 2
Approximately 10О,ЄООв.ОіЕ,
Approximately 2,200 generations after Ash and Elm
The First Exodus: Map Location 2
each pole, the amounr odweierallhnnquator decreased dramatically. The majority of the African contrnuurnodhoy therauaterwoeeagulfeO hytha Sdiara dessert as it grew due to severe drought. The portions of humanity that remained in Africa could
Ctataes dt ote cidoaoe catsem ote uriar dce caus or sOeiia Wdot ot who had left AfrieathroesOGaoo weoeiroaped, nceieql.atriaiene;>em.iar;irOeiiC.ei;y. was Africa and uneble doesove meeOTmrtCer tale eheMidOla EestAstEy desertc approached fromah sideet ittoireiUiaeiliRiilied.

Migration from the Womb
In Africa, our ancestors huddled along the Southeast Coast. To survive, they changed
Liber ab Exodus (Book of Departure) mary diet. Forced into smaller areas, theirrncreasixg pus ulatioogrowtoa poinUwhere the shores of Africa were no longer able to support them. A second attempt at exodus
In Africa, our ancestors huddled along the Southeast Coast. To survi from hunter-gatherers to beachcombers. Shellfish and other seafood b mary diet. Forced into smaller areas, their increasing population grew the shores of Africa were no longer able to support them. A second at sbeeacalemveelawmaas t1te5r0 offeesut rlvoiwvaelr. tFhraonmitthise tEodasaty.CForaosmtotfhAefAricfraicaatnthceoaGsta, across the Red Sea to see the green of the Yemen Mountains.
Approximately 3,500 Generations after Ash and Elm
The Second Exodus: Map Location 3
Approximately 78,000 b.c.e.
Approximately 3,500 Generations after Ash and Elm
small as 250 people. Within its small number were two women of unique importance to
The second exodus at about 78,000 bce landed one community of Yemen, on the East Coast of the Red Sea. This is the beginning of all h of Africa. It was in essence the first New World. The community m small as 250 people. Within its small number were two women of uniqu this story. They were both descendants of our Elm as well as descen spring, Mitochondrial Eve. Their exodus from Africa is the single e eventually lead to the population of every corner of the globe.
This is not saying that everyone who migrated from this point wer tahteesre, atwopewoopmeeonuitfs noetopasserdcaonwodiurectclayrfrryotmeounne qouf ethme ttwoco othnenr fa descendants intermixing DNA with another line.
Approximately 3,550 Generations after Ash and Elm
Migration Along the Coasts: Map Locations 4, 5, and
Approximately 77,000 b.c.e.
Approximately 3,550 Generations after Ash and Elm
Map Location 5—Some settled in Iran, moving inland to the east of the Ural Moun-
Map Location 4—After about a thousand years, our family again separ remained in the Middle East, spreading into Saudi Arabia. The o into Iran, following the coastline.
Map Location 5—Some settled in Iran, moving inland to the east of tains. Others continued to move along the coastline into India.
The Toba Volapno Eoupte: Map Location 7
Approximately 72,0(Юо.с.е.
Approximately 3,800 Generations after Ash and Elm
72
The Toba volcano in Sumatra erupted, sending plumes of ash 25 miles into the sky.
72 A Wiccan Bible
East experienced a volcanic winter for 6 years. It wa s themonn Bestrective event in the last two million years. Probably in an attempt to flee the affected areas, the group that
The Toba volcano in Sumatra erupted, sending plumes of ash 25 m The resulting cloud of ash reached as far as Northern Malaysia and In East experienced a volcanic winter for 6 years. It was the most destruc last two million years. Probably in an attempt to flee the affected area Maonmgoolviaen sttoewpasr asndt iento mSiabearyiaas. T( he) gcrroousspethtatewasmnaoratyhaso,fmtho moved north along the east coast of Vietnam, and into China.
Approximately 4,000 Generations after Ash and Elm
The Survivors of the Toba Eruption: Map Location 8
Approximately 68,000 b.c.e.
Approximately 4,000 Generations after Ash and Elm
man race, crossing more than 100 miles of ocean to a world they could not have known
The survivors of the Toba explosion that escaped by the souther onto the landmass that is now the islands of South East Asia. But they Within just a few thousand years, they faced the second successful e man race, crossing more than 100 miles of ocean to a world they could existed prior to their arrival. Unlike the crossing of the Red Sea, there fsohuonreds. vTishiebslee bmeefomrbeetrhseoyfleofut ranfadmtiolythfoisudnadytaherierahsoonmfeo, rrtehmeairinjoinugrn becoming known today as the Australian Aborigines.
Approximately 4,700 Generations after Ash and Elm
The Extinction of Megafauna: Map Location 8
Approximately 51,000 b.c.e.
Approximately 4,700 Generations after Ash and Elm extinct. There is no sign of over-hunting or any large-scale slaughter, just the first ex-
When our family arrived in Australia, just 700 generations earlier, a new world filled with wonder. They were met with 9-foot kangaroo, of cars, and an array of other megafauna. By 51,000 b.c.e. all megafa eaxmtipnlcet.oTfhhoewretihsenporesisgenncoef oofvheru-mhuanntiitnygteonrdasntyo lhaarvgee-ascdarlaemslaatuicgihntfelru, ronment whether or not that influence is intended.
Approximately 4,900 Generations after Ash and Elm
’The olden days are alas turned to clay,
Liber ab Exodus (Book of Departure) How could I bespeak evil in the Assembly of the Gods, Ordering battle for the destruction of my people,
’The olden days are alas turned to clay,
Because I bespoke evil in the Assembly of the Gods,
How could I bespeak evil in the Assembly of the Gods,
Ordering battle for the destruction of my people, When it is I myself who give birth to my people! Like the spawn of the fishes they fill the sea
—Ishtar speaking of the G
From the Gilga but the Lebanon and North Saudi Arabian deserts prevented that migration. The first
As humanity migrated along the coastline, we left behind settle became the great cultures we see today. The community that forme East, in the area of Saudi Arabia, might have migrated north prior to t but the Lebanon and North Saudi Arabian deserts prevented that mig Great Flood changed that, opening up the Fertile Crescent and maki deserts passable.
Although this event took place about 50 thousand years ago (48 oldest surviving stories are only about four thousand years old. The o the Sumerian story (2000 b.c.e.). This does not mean the story was no lier, it just means that we have not yet found earlier record of the however, found archeological and anthropological evidence that places
The earliest knownusferencetothof(4s8 (ireat Flood canbefouvdin theSumerihn story of an elder cptizennamfdUCnaaishtim.Hahingreneiced knowlnngeoftheoend-ing flood from Ea(Swoero-lumananitin gcdtiUtnanyshdimeuilt ahceaisltipii.td slouoed zeedeics fddiabedc dhc cedifezc nf hemfeady aedn aeinec dn dhas cvced. that it found no otheTpicce in land.He ihcneent nuta awallow,andildzareiurned.
UdoiytoftaetceecitzadazceteancetUdeaeaUhdan.tHavaenticzcavcetkeoeec place to land, he dn ewiheilon Ewasonco
After finding din lancl.l'icmedctacril’icelorlysdeliceraio’c 1 eehumbl edwera iee dhad id enede dn ndhci eeazc dn eade. Hc dhcd Ucdd ned a Ueaeene, ade nidaeey, hc Ucda a iavcd, ehizh eie dna icaeid. Bceicvidn ia neUa hav granted UtnapishtimimmOTdahh^peowritm1 nuaoeaguinto cause such an event.
Kll::riiSc| ^.пІОо.єU.aeii- evasion of che BaUo-oniao Nnrhr became
enreeoahtaoahcyoeceaonrctaorcnnrUcoenrohtvidnokieeceoUnontdyoeiahoahc the Gods. In respon(airllugot^s hronghtfortd ehe Bonn. UidnrciUtotsaae tteW“Uuez tion of humanity, Ishtar swears on her lapis that it will never again take place. In the Babylonian storyBUtnonishtim’snama isZiusudraendheteweunud neAcui^na .the Assembly of Godciralii^er taenarn tndzuidheZ, butotnerahaw(hoeevaetanoei(Ze(torn is essentially the somp.
Hindu/Near East—Prior to the Great Flood, a man named Mann was fishing when he
74 A Wiccan Bible
it did, telling Mann that its name was Matsya and AleWngahat Manu not kill him, but instead grant protection from the other fishermen until he could grow into an adult.
Hindu/Near East—Prior to the Great Flood, a man named Manu was came upon a small fish with a talent unusual for most fish; this one cou it did, telling Manu that its name was Matsya and pleading that Manu instead grant protection from the other fishermen until he could gro Manu granted the small fish his desire and placed him in a pot of wa sure no one else would catch the poor little thing. When it grew, he pu pot and then a bigger pot until he had to place it in a lake and then Upon placing the huge fish in the ocean, it warned Manu of the impe instructed him to build an ark. Manu, realizing the fish was an incarn

The Story of the Flood Moves North
Greek account—Warned of the Great Flood by Prometheus, Deucalion built a great ship, an ark, which carried him, his wife Pyrrha, and stores necessary
The Story of the Flood Moves N
might be a commentary on his replanting of the vineyards.
Greek account—Warned of the Great Flood by Prometheus a great ship, an ark, which carried him, his wife Pyrrha, and to repopulate the Earth. Deucalions name means New-wi might be a commentary on his replanting of the vineyards.
The survivors of the Great Flood moved into Europe. A too, left behind communities and pockets of humanity tha came the great tribes of Europe. Many of those tribes late exodus from the Middle East and entrance into Europe i that followed.
husband Fintaan, and a tribe of maybe 200 people. When the flood receded, Irish account—Warned of the impending flood by his fath the Christian story), Bith and his wife Birren traveled to the husband Fintaan and a tribe of maybe 200 people. When th Bith and Birren became the first couple to enter Ireland lea their tribe.
Welsh account—Dwyvan and his wife Dwyvach built a ship n Nav Nevion filled it with animals survived the flood and Welsh tribes.
the Great Flood made the land livable. Some accounts state that, rather than
Liber ab Exodus (Book of Departur waters of the flood from which to carve humxmtyu
wraotmers vofntghterefleoso, d fronmsewehcicteh totwcoarvoegshutmaat nwiteyr.e oatng n t
Some cite Germany as the first place humanity meets NeandertaL If this meeting occurred, it is likely that Neandertal man was a migration out of Africa that occurred
Neandertal Man: Map Location 12
further evidence of the existence of Neandertal. Like the extinction of megafauna in
Some cite Germany as the first place humanity meets Neanderta occurred, it is likely that Neandertal man was a migration out of Afri much prior to the migration of humanity. If that is the case, by 38,000 further evidence of the existence of Neandertal. Like the extinction Australia, without any evidence of war or large-scale conflict, upon m the Neandertal simply became extinct.
However, there are a growing number of researchers that believe simply did not exist. Instead, the evidence found might have been the portion of humanity that migrated too quickly for sexual selection to hav skin. This school of thought says that the remains that were given the n were actually shorter humans with sloped foreheads because they suffe D deficiencies and the degenerative state of the bone structure known is the case, those bones would not contain the DNA record of the migrat step of humanity outside of Africa. Ol'thatl'act, botheithes agreeo r rgnoxod
While both schools of science exist in conflict on this matter, there geieoiu evideiue ohto fouad aetd t persoi oo beaieve Netiderota fts Approximately 22,0P0r.c.E.
Approximately 6,000 generations after Ash and Elm
The First East Coast Entrance into North America: Ma
Approxi.toeaA 22,000 b.c.e.
Approxi.toeaA 6,000 geiertoiois tgoer Asc tid Ea.
direction because any migration west or north was blocked by the thick sheets of ice
Agoer urossiig oce Hi.tatAts tid .oviig ocro.gc Siberit, ocis t .oved etso oo uross iioo Noroc A.eriut to oce Betriig Sortios. Wc
The Second EashAoostEntoance mto North Aaaonrica:
ohtoouoveredooheo.tjorioAoogoNorohoA.eriut.
Approximately 10,000 b.c.e.
The Second East Coast Entrance into North America:
Map Location 9
Siberia, continuednosth,an0 ecentuully went east into North America. These folk also headed south to escape the sheets of ice that covered North America. But the ice had
76 A Wiccan Bible
them to migrate not only south, but also southeast. Aurrent thinBnb is that this sheet of ice, glaciers, were completely gone by about 8000 BCE. But where did they go?
headed south to escape the sheets of ice that covered North America. started to melt as a result of similar climate changes mentioned earli them to migrate not only south, but also southeast. Current thinking is ice, glaciers, were completely gone by about 8000 BCE. But where di
While it has been speculated that there was one great world flood the lore of Eurasia as well as North, Central, and South America, I rank right up there with the popular Fundamental Christian belief th took place only 4,000 years ago and that our world is only 5,000 years is wild speculation on my part, but I think the result of great volumes o might be great volumes of water. Again, perhaps this is wild speculatio I think that perhaps the Great Flood recorded in Eurasian lore was

North America—The Arapaho creator, Neshanu, is recorded as being responsible for the second Great Flood.
North America—The Pawnee creator Atius Tirawa/Tirawa, is recorded as
North America—The Arapaho creator Neshanu is recor sponsible for the second Great Flood.
North America—The Pawnee creator Atius Tirawa/Tiraw being responsible for the second Great Flood.
Central America—The Mayan god Hurakan is recorded as ha flood to punish the first of humanity who had dishonored and
South America—The Brazilian god Anatiwa is recorded i Karaya as being responsible for the second Great Flood.
Flood.
Flood.
Map Locations 13, 14, and 15
Approximately 1000 c.e.
The Third Entrance into North America:
Map Locations 13, 14, and 15 Approximately 1000 C.E.
documented in Newfoundland and at each of the points indicated on the map as lead-
Liber ab Exodus (Book of Departure) when leaving Africa found union in NorthAmencx.Infact,therei s cl ear evirtucethat they traded with the folk who entered at the West Coast.
documented in Newfoundland and at each of the points indicated on ing there, Iceland, and Greenland. So, we know for a fact that our fami when leaving Africa found union in North America. In fact, there is cle they traded with the folk who entered at the West Coast.
Approximately 7,000 generations after Ash and Elm
Humanity Again Finds Union
Approximately 2000 c.e.
Approximately 7,000 generations after Ash and Elm creating such works. I am not proposing such an easily believed theory on this. Just the
I have heard a great many stories that link Stonehenge, the Pyrami North American Earthworks to unidentified flying objects and extrat The underlying theme in those stories is that humanity would not have creating such works. I am not proposing such an easily believed theory opposite, I am proposing the seemingly hard to believe idea that ma humanity was able to create these wonders of the world—that maybe, j creator IS evidenced by our creativity.’ That, my friends, is what I h most sacred message behind the Wiccan religion!
inform and moving how express and admirable!
What a piece of work is a man! how noble in reason!
the boauty hOthe world! ihe pararon of animals!
—William Shakespeare, Hamlet act 2 scene 2
the palagoi of aii!als!
not really matter if it was carried with the Eastern Migration, the Western Migration,
—WaiiaS! ShSkespeSle, Hamlet S fact is, by either archeological, anthropological, or DNA evidence, the story remains
The measuring system developed in Africa is discovered in North not really matter if it was carried with the Eastern Migration, the We or even if it was developed independently in all the many places it ha fact is, by either archeological, anthropological, or DNA evidence, t relatively the same. We are one people, separated as we left Africa o in North America. We are one people ’separated for the sake of union,’ edge in and of itself can be our salvation.
We live in a time when humanity is divided by both religion and reg of Palestine (predominantly Muslim) and the people of Israel (predo continue to kill each other. The people of India (predominantly Hindu so seemingly similar, as with the Irish Catholics and Protestants, it does seem as if we
78 A Wiccan Bible
I am not saying that any one side in these matters is to blame. The gods know and my service record attests to the fact that I am a patriot. However, I am also a member so seemingly similar, as with the Irish Catholics and Protestants, it do are wildly divided.
I am not saying that any one side in these matters is to blame. Th my service record attests to the fact that I am a patriot. However, I a of the human race. So I pray this message reaches the leaders of both s all conflicts. That message is that we are all members of the same fa One People. In saying this, I do not mean that this book should be o President or in the hands of every world leader. What is important is t which is not at all an original thought, is presented to the world leader we and the other religions of the world conduct ourselves.
In closing this chapter, I should mention that I am neither archeol pologist. I am just some Joe trying to make sense of my world and s made sense for me with you. But even if I held a degree in these fields will change with time and new discovery.
Thank you for the liberty and freedom by which I am allowed to write this book.

Liber ab Quattnor
Liber ab Quat
Our Reunion Begins Now
my
'fyat&i гну бІмсС Діл гну faieatk ?eic mtf. aftinit
—rfcttftofi 'Мм&шмшг
fur Mother Earth and Father Sky are threatened. With that threat, our children are in great peril. Somewhere along the way of our migration, we for-
—A
and Fenris is scratching at the door! Everywhere I look, I see Ragnarok just ur Mother Earth and Father Sky are threatened. With that dren are in great peril. Somewhere along the way of our m got that we are one people! The Nameless One has been give and Fenris is scratching at the door! Everywhere I look, I se a stone’s throw distant, the doom of the gods, and we are j ascend to their position. Is it not the sacred duty of an Earth religio Earth? Is it not the sacred duty of a fertility religion to protect our c Mother and Father, and it is their Daughter and Son. It is the sacred marriage in which
ss ch
en
80 A Wiccan Bible
find sacred and the path by which we find it. At A werycorn,it is the number of reunion. And with that reunion, we remember and truly become as we were before sepa-
Mother and Father, and it is their Daughter and Son. It is the sacred m one Mother and Father are united with another Mother and Father. It find sacred and the path by which we find it. At its very core, it is th union. And with that reunion, we remember and truly become as we w ration, one people.
We live in a three dimensional world. But until relatively recently, about it in only two dimensions. Prior to the use of airplanes and could move forwards, backwards, to the left and to the right, but neit for any appreciable distance. At a very early time, humanity must have offer directions to others to assist them. Maybe someone found a r tree, took a few apples, and brought them home for his wife and him
A second man saw the first and his wife enjoying those mighty wanted one for himself. The first man knew there were plenty of ap apple tree, so he didn’t see any reason to fight over those apples, second man an apple. A third and fourth man saw the second man eat mighty fine apples and asked him where he got it; he told them he re from the first man. So the third and fourth man went to the first man a each wanted an apple.
Something had to be done. He couldn’t just point to the apple tre were obstacles in the way. So he told the second and third man to g return home. Theywentducu tothat linallaiidmardaiidagaiii tunied gihht,leading them in the wrong direction. Itb echmeobviourtUattu describudirections ,bheyne rded time.lWherltheylfiryllylietuired,ltheyl,eielmightylputliff.lTheylhyd
Morning aftesmomnf.oneeohedfheethudasthndwitnesssunrisu. Iweihiigaetcr evening, one could faceWusdond wilnesethe sunaeUBhynusnlhe sun eawa^reeygndsetm the same place, those firrt fonr priucrdleecreutione couam0 ebit.iiutedhiettheit.hdbiiiinseos y dsxoe iodoiorco. Fuiihryioin, ihon hye oxyciin ,hyi ihon rooeoe yiio
Musrsrg ydies eusrsrg, ure cuhie dyce ihe Eybi yre ,sirebb bhrss neys would be takenbgringtheday, thwioelcul choiee tor slesencewat ouhrish.Our simple concept oOdoawardibdcioubdd, left,and ticghi bedomuuniohrealrefhaenees m direction.
esrecesuusl,sehlylredereucelehyelyiilcuhielreiyeeleulylssugieltusue.lee
ssetielcu |
tceteludldur,yre |
esrecesut. |
East |
Fycst |
lshtrsserlehuseles |
Behind me |
|
To my left |
Description North |
The Four Quarters
With a standard set of directions in placeitbe cQmetasotoBeocrib e noFonlyplaces to which one could travel, but also places from which one came. It became easy to state
The Four Quarters
East come raiders from rival tribes. So we see the development of guardians for each With a standard set of directions in place, it became easy to describ to which one could travel, but also places from which one came. It beca that the winds that come from the West bring storms and bad weather East come raiders from rival tribes. So we see the development of gu of those directions. Certainly in early cultures these guardians may hav
Egyptian Creation Story—Africa
sof th, |
sfpr,nc,plef,nftheffo |
fveryfreafworfnee urfsonsfoffHorus. |
forfprotecton. Element |
Eg |
Fcneiat |
ony—Afr,ca |
Water |
Shu |
Male |
East |
Air |
Geb |
Name |
GeFden |
DinectioF |
Nut |
Tefnut |
Female |
West |
Geb Male North Earth
Nut Female South Fire
the four principle directions and associated with an Element, a human organ, and a protective goddess. During the process of mummification, the associated organs were removed and plaFou incanopHj'rus t—At wcae carved, etched, or shaped like the god they represent.
Direction |
protect,vefgo |
ddess.fDur,ngfth |
efprocessfoffmumm |
,f,cat,on,fthefass |
East |
removedfan theyfreprese |
fplacedf,nfcano nt. |
,cfjarsfthatfwerefca Duamutef |
rved,fetched,forf Neith |
South |
Water |
Liver |
Imset |
Isis |
West |
DinectioF |
ElemeFt |
OngaF |
God |
North |
East |
F,re |
Stomach |
Duamutef |
West Air Intestines Kebechsenef
names may change with time and migration, the principles remain the same. Migrating North Earth Lungs Hapi
Near East.
I I 1 X- If,
names may change with time and migration the principles remain the eastfalongfthefcoastalfareasfoffthefInd,anfOceanfwefseefth,sfpr,nc,p NearfEast
Lokapalas Four—Near East
82 |
God |
East |
Indra |
Lokap |
alas Four—o |
West |
Direction |
North |
East |
W
Direction |
nrth |
East |
Indra |
Lokapal |
as Eight—oa |
South |
Direction |
South West |
East |
West |
Snuth East |
North West |
Snuth |
North |
Snuth Wost |
North East |
Wost |
North Kubera
Ling and the Mo Li.
Ssu Ling (Also known as Ling)—Male/Female—Central Asia
The four creature guardiangoa Cainngemyindiony oimilaatotneWicctnConrQuAr-ters. They are Ch’inhiiFenhOaMinL Gui Xian, and Long.
su |
Ling (Aisn knnwn Name |
as Ling)—aaio |
omao—ontr |
Th tors |
fnur iroaturo gua . Thoy aro Ch’i-iin, |
rdians nf Chinos Fong-huang Gu |
o mythningy sim i Xian, and Lnn |
South |
Feng-huang |
Phoenix |
Male |
West |
Direction |
Name |
Animal |
North |
East |
Lnng |
Dragnn |
The Mo Li—Central Asia Buddhist Four Quarters.
Direction |
God |
The M |
Chcne |
Buddh |
isg Fiul Quilgl |
West |
Direction |
North |
Eisg |
West Hai
North Shou
images are still found in the temples of that area. Each is shown fully armored with a different skin color and holding different items in accordance with the direction they Tian-wang (Also known as T’ien-wang)—Male—Far East/Central As
King (nonnmc nioen) |
ef ie ghn gno |
King of ffienetaO |
fiheif |
King ofthe Soevn |
Blue |
King of the West |
R.ed |
King of the NortK |
hn Eiog |
King of the West Red
the island of Japan and the surrounding area where we see the development of the Shi Tenno.
Shi Tenno—Far East
Direction |
ef if Ji.ie ief |
Tneei |
. |
South |
nnoCFil Eiog |
West |
Direction |
North |
Eiog |
West Zocho
directions as far east as Japan waiting to make the cross to North America with the North Bishamon
opened up northern migration. Back in the Middle East, we see the northern migration bring the HebrTwprineiples ofthefoui dinacOloneandtheieevolufiooineotge practices of Chridtianceeemonial magicians.
Direction |
Arch Angel |
Element |
84 |
Raphael |
A Wiccan |
South |
Michael |
Fire |
West |
Direction |
Arch Angel |
North |
East |
Raphael |
West Gabriel Water
Roman pantheons. With those pantheons, we see again the principles of the four carNorth Auriel/Uriel Earth
both the Greek and Roman pantheon.
Into Europe along the Mediterranean, we see the development o
Roman pantheons With those pantheons we see again the principle
din bot |
al directions and th h the Greek and R |
eir guardians. These gu oman antheon |
East |
Eurus |
Vulturnus |
Gre |
ek and Roman Go |
ds of the Four Winds— |
West |
Direction |
Greek God |
North |
East |
Eurus |
West Zephyrus Favonius
key interest, they also included the cross Quarters of those cardinal directions as follows.
Direction |
Greek God |
Alth |
ough the Greeks did |
key inter |
est, they also included |
D |
irection |
E |
ast |
S |
outh East |
S |
outh |
S |
outh West |
North East |
est |
North Boreua
pean principles of the four directions develop.
Norse Four Directions—North Europe
Direction |
Lib |
er ab Quat |
East |
Jotunheimr |
Air |
Norse |
Four Directions— |
orth Europe |
West |
Direction |
Realm/World |
North |
East |
otunheimr |
West Vanaheimr Water
North Niflheimr Ice
facing each direction and each associated with the four Elements: Air, Fire, Earth, and Water.
Svetovit—Male—Central/North Europe
Slavic god of the four directions. He is depicted as having four sepa facing each direction and each associated with the four Elements: Air, Water.
Althou |
gh this is indee |
the fo |
r directions an |
are ge |
nerally seen as: |
West |
Direction |
North |
East |
West Water
this chart does not reflect how all Wiccans draw the association. Yes, this set of associa-North Earth
wrong by any stretch of the imagination. As Wicca developed, it looked desperately for
Note that while this is how I associate the Four Quarters with th this chart does not reflect how all Wiccans draw the association. Yes, th tions is the most often cited, but there are exceptions, and those ex wrong by any stretch of the imagination. As Wicca developed, it looke evidence of surviving tribal tradition, practices that were not entirely the destruction of written and oral traditions by the burning of libra that search, the Wiccans of North America looked to the indigenous America. There, too, they found cultures that were virtually destroy and traditions whose last gasps were still audible. One of the many th ered was the principle of the four directions and guardians of those d most prevalent in Wicca, is a combination of the similar attributes of the Sioux and
Native American Quarter Associations—North America
It is important to note that the directional associations change with t
Direction |
Animal |
86 |
Eagle |
South |
Elk |
West |
Direction |
North |
East |
North Wolf
Who hasn’t been moved to tears by a movie or play? Who has not left a theater house with a new perspective on the world in which we live? Theater often provides us
The Four Tools
the living of life is what is most important, ritual often stirs that living into action. It Who hasn’t been moved to tears by a movie or play? Who has n
house with a new perspective on the world in which we live? Theater o with secrets, which stir the mysteries of our soul. Wiccan ritual is no the living of life is what is most important, ritual often stirs that livin reveals secrets that cause the exploration and thus understanding of the world in which we live. Although our rituals are themselves theate because they represent that which we call sacred. Thus, we use the term
As with any theater, props are often used. Those props are more
Direction |
itself a tool |
. However, there |
are four tools tha |
t are considere |
East |
tant. This i |
s because these a |
re the four that ha |
ve direct associ |
South |
ters, the ge Fire |
nder of those Qu Athame |
arters, and the prin |
iple of those Q Chalice |
West |
Direction |
Element |
Tool |
Gender |
North |
East |
Air |
Censor |
Masculine |
West Water Chalice Feminine At
of ritual. Being Wiccan is a matter of heart and the way one conducts themselves in life
North Earth Pentacle Feminine Ce
on these tools as just that, things used in ritual, sacred theater, to represent what should
While these tools are not at all necessary to be Wiccan, neither is
on these tools as just that, things used in ritual, sacred theater, to repre be taking place in the hearts of each and every one who would call the
tool associated with the Element Air and the prayers sent to our Father Sky.
The First Union—Censor and Pentacle
ion) is felt necessary, the following recipes are used. These recipes are also useful in the working of spells that draw on Air energy and it is the preferred incense for burn-
Liber ab Quattuor (Book of Four)
Air Incense
the working of spells that draw on Air energy and it is the preferred i ing in the censor during its use.
Air Incense
2 parts Lavender flowers
1 part Benzoin
Enough Air or Lavender oil to bind
Air Oil
1/2 ounce Almond or Palm oil
9 drops Lavender
3 drops Pine
1/2 ounce Almond or Palm oil

Humanity on Earth
Prior to the first use of the pentacle and when ever cleansing and charging (rededication) is felt necessary, the following recipes are used. These recipes are also useful in Humanity on Earth
Earth Quarter.
cation) is felt necessar tEhaertwhoQrkuinargteorf spells
1 part Cypress
Earth Incense
Enough Earth or Bergamot oil to bind
Earth Oil
88 A Wiccan Bible
9 drops Bergamot
Earth Oil
12 drops Patchouli
9 drops Bergamot
1/2 ounce base oil
dren (the union of pentacle and censor) at center. In this union, the direction is as-The Union—The union of censor and pentacle is like the Druid tree t in the first half of Book of Three. It is the symbol of Mother Earth who is below, Father Sky (the rising smoke/branches) who is above, a dren (the union of pentacle and censor) at center. In this union, the cending above as the smoke rises to the heavens. It is seen as Mothe for Father Sky and Father Sky accepting her embrace
essence the symbol of his phallus. Different traditions of Wicca have unique specifica-
The Second Union—Athame and Chalice
double edged. The reason for the dark handle is because darker colors absorb light The Athame—The athame is a knife that represents the lightning of essence the symbol of his phallus. Different traditions of Wicca have u tions for the athame. Most agree that the handle should be dark and t double edged. The reason for the dark handle is because darker col more readily. It is thus believed that with a dark handle the athame will c energy better. While this might indeed help one visualize the conduc
it is necessary to pooulopOthaOth e tiestde icgiptionofdhhtmanickal enerttrisbioerecs trie. So I do not feela OnrkOiaydlaitalgsoliOciy neeessaryt etaeciailynotwhenthat the ithime ie oOOe, ohtch ts fOt Ofe Of the iettei cOfeuctOis Of i
Generally spcnMgg, the cthamc^fadoiiblcbladn.^etNadc bemg ngmbohc af tt te fncneeiis ta patft aut thit thn inet enecitpttaf af thit iigtckil n tito. Sa I ea nat accl i eiig hinelc te iiealutcls ncoceeiis, cepcotill tnnci vatoc hie eclcotce i taal otth i ltght hinelc.
Gcnciills epcigtng, thc ithiic hie i eauilc iliec, thit iliec i aui Laie ine Lies. Thcs iic thcieclvce ecpiiitc, iut icigtng ie o
The Athame

otal Length
The Athame
Prior to the first use of the athame and whenever cleansing and charging (rededicat-
Liber ab Quattuor (Book of Four) working of spells that draw on Fire energy and are sometimesburned atthatQuarter.
Fire Incense
Prior to the first use of the athame and whenever cleansing and cha ion) is felt necessary, the following recipes are used. These recipes are working of spells that draw on Fire energy and are sometimes burned
Fire Incense
2 parts Cinnamon
1 part Dragon’s Blood
1 part Frankincense
Enough Fire or Allspice oil to bind
Fire Oil
1/2 ounce base oil
6 drops Allspice
3 drops Bay
3 drops Ginger
1/2 ounce base oil
particular preference. Many folk give little thought to the selection of the chalice. Cer-The Chalice—The chalice is a drinking vessel that represents the ocean is in essence her womb. Although very few traditions have specific r this drinking vessel, it is generally made from earth, glass, or metal, particular preference. Many folk give little thought to the selection of
Prior to the fiainuse oflhe chaliceandwhy nevhe cleansingandehprnhsw-rh (tse.-cation) is felt necesaaoy, thefollowinucecipvs cks uoea.Theso recipes aee acsousefulin
theyscosplisentseachsothei.sThesdepthsofstheschalicesshouldsthens thacsthesbaaiesyfsthesathasesissayci.
Piiyistysthesfiistsusesyfstheschaaicesaciswhecseveiscaeacsicisacisc Water Incense
catiyc)sissfeatscecessaiy,sthesfyaaywicisiecipessaiesusei.sThesesiecipess theswyikicisyfsspeaasswhichsiiawsycsWateiseceiiysacisaiessysetis WateisQuaitei.
Water Incense
2spaitssJassicesFayweis
1spaitsLesycsPeea
1spaitsCasphyis(catuiaa)
EcyuihsWateisyisLesycsyiastysbici.
Water Oil
6siiypssCasphyi
3siiypssLesyc
3siiypssEucaayptus
3siiypssCaiiasys
simply a symbol of the sexual union by which humanity creates. It is also the marking of
90 A Wiccan Bible
primordial ocean (chalice) was repeatedly struck whhlightainn (athaee). In this union, the direction is descending below as the athame lowers into the chalice. Father Sky has simply a symbol of the sexual union by which humanity creates. It is als the initial creation of life on this planet. Science now believes that life
already accepted Mother Earth’s embrace with the union of censor an we see that embrace consummated.
So what should be going on in the hearts of each and every Wiccan? The answer to that is the influence of the Fifth Element, that force which causes both division and
The Fifth Element
Book of Exodus) it seems rather clear that the time of union has come. While there
So what should be going on in the hearts of each and every Wiccan that is the influence of the Fifth Element, that force which causes b union, the mania by which we create. As our division has all so clearly Book of Exodus) it seems rather clear that the time of union has co
t Earth for our ch

So important is the Fifth Element, sometimes called Spirit, that it has been incorporated into one of the predominant symbols of the Wiccan religion. It is the top point of the pentagram. This gives one the sense that creation is a matter of intellect. Indeed it is, but if we look at the format of Wiccan ritual and the use of the tools we see a
So important is the Fifth Element, sometimes called Spirit, that it


Ki and the Four Quarters
The diagram “Ki and the Four Quarters” places the four Elements in accordance with how the pentagram is most commonly depicted. Understanding the meaning be-Ki and the Four Quarters
gram around your neck, do the Elements apply to someone looking at you or you looking
The diagram “Ki and the Four Quarters” places the four Elemen with how the pentagram is most commonly depicted. Understanding hind this placement is a bit more difficult than can be drawn. Should y gram around your neck, do the Elements apply to someone looking at yo at the person? In respect to the Fifth Element, it is always the top po gram. However, when we address the principle of Spirit being center, for the placement of the other Elements. Air and Fire are placed wit tion of the torso because the upper world (Sky) is considered masc
If you are involved in the martial arts or if you have taken even the most introduc-
92 A Wiccan Bible
this is the same principle discussed in just about eveW I'ormol'tnartial arts that has come out of the Near East, Central Asia, and the Far East. It is the source of all cosmic
If you are involved in the martial arts or if you have taken even th tory course, right about now a light bulb over your head has just been s this is the same principle discussed in just about every form of mart come out of the Near East, Central Asia, and the Far East. It is the sou energy in relation to the human body. It is the center, the balance poin thhuemWanicbcaondyriftruoaml awnhdicthhefocrecneteisr aopfpoluierdb(osdepaIrtaitsionno)t osur rdrraiswinn (uthnaiot related to the center of our world the Earth itself —not the center o the center of ’our world’ and of our Earth-based religion.
Ki—Female—Middle East/Mediterranean/Near East
Sumerian personification and goddess of the Earth. Her Mesopotam counterpart is Aruru.
Aruru—Female—Middle East/Mediterranean
Mesopotamian personification of the Earth. Also known as Assyrian counterpart to the Sumerian Ki.
three as seen in the four Quarters. That is the commentary of union in the form of
While it might seem at first glance that the position of Air and Fi
and (Fire/
ach other at ce
З-Daughter (Bride) З-Son (Groom)
2-Earth (Mother)
2-Waier (Mother)
1-The Cycle Begins Again
Marriage and the Four Quarters
To preserve this message in the four Quarters, Fire is placed above Water as opposed to being placed across from Water. Likewise, Air is placed above Earth, not
Marriage and the Four Quarters
Fire represents sudden change, the type of thing one might expect from the right half To preserve this message in the four Quarters, Fire is placed abo posed to being placed across from Water. Likewise, Air is placed a folk who reverse the association based on the predominance of their hands. Should
Liber ab Quattuor (Book of Four)
I believe this is because the dominant hand er consQuaed toe ffliewst likely to cause sudden change (like the Element Fire).
folk who reverse the association based on the predominance of thei they be right handed, Fire is on the right. Should they be left handed, F I believe this is because the dominant hand is considered the one mo sudden change (like the Element Fire).
When we acknowledge that the force that brings those Elements an in Wiccan ritual, we see that the four Elements, brought together b indeed the very Druid tree we spoke about in Book of Three Part I. Our
worlds. We are that Spirit and thus, the four Quarter’s union. For three that drives the principle of the four Elements to cause all life.
^З-Daughter (Bride) З-Son (Groom) -I I— З-Daughter (Bride) З-Son (Groom)^^
Ul Г II I
2W^ (Mother) l-Faeh(Me)her) 2-Water (Mother)
2-Daughter (Brideh 1-Son (Groom)
З-The 2ycle 2eginsAgMш
Generations and the Four Quarters
The Four Quarters as Union
Generations and the Four Quarters
I was first introduced to the principle of four long before my eyes were opened to it. I had seen the four Quarters called time and time before, but the tremendous sig-
The Four Quarters as Union
for two friends who were getting married. In that ritual, I suggested that the parents of
I was first introduced to the principle of four long before my eyes it. I had seen the four Quarters called time and time before, but the nificance had escaped my young mind. As an adult, I had written a h
both groom and b |
ide stood at the four Qua |
significance really |
les. However, it was not u sunk in. |
Father of Groom |
North Europe |
Role in |
Handfasting Appa |
Father |
f Bride Cent |
Before me stood four people of wildly different ethnicity who had come together
94 A Wiccan Bible
the union of his mother and father. The rule of three Wwdaaso crebted the bride in the union of her mother and father. But it was the love of groom for bride and bride for Before me stood four people of wildly different ethnicity who ha to unite a man and woman as husband and wife. The rule of three crea the union of his mother and father. The rule of three had also created union of her mother and father. But it was the love of groom for bri groom that brought these parents together. That love is the Fifth Ele Years later, I learned about mitochondrial DNA, and my long-st belief that we all started out as one people was confirmed by science tion caused me to think about those friends whose lineage is so wildly wedding. It struck me like a brick. This is the knowledge that would s thought it was so profound, that I brought it up to my mentor. She was ’discovery’ but also used the opportunity of our discussion to ask m following Saturday morning while her kids watched cartoons.
After arriving at her house, I was surprised to find that she had n she handed me some popcorn and had me watch Saturday morning c 6-year-old son and 4-year-old daughter. As we watched cartoons, w and her kids each interrupted to say that I was talking about Captain I knew who Gaia was, but had to ask about Captain Planet. They desc
childre Green mouth
And never ending
I W W A
—Popular chant, original author unknown
n never enng
—Popular chant, original autho
Warning: Rethinking Ahead!
How Did Wicca Decide Which Quarter Is religion, you might want to move on to the next chapter. Indeed, most folk like them Warning: Rethinking Ahead!
ritual, please consider the following as a reason why everyone is welcome to do so.
If you are happy with the four Quarters presented most often in tex religion, you might want to move on to the next chapter. Indeed, mo you that you are wrong. So be prepared for criticism if you vary from the accepted
Liber ab Quattuor (Book of Four)
You might have noticed that when I spoke about the blending of Native American spirituality with Wicca to form the four Quarters, I did not say the European influence you that you are wrong. So be prepared for criticism if you vary fro norm. But here is some fuel for your rebuttal.
You might have noticed that when I spoke about the blending of N spirituality with Wicca to form the four Quarters, I did not say the Eur was Celtic in nature but that it is reportedly Celtic in nature. You also that the system of assigning Elements to the Quarters most often used sponds best to the system that is perpetuated by Hebrew-based cerem Here we see something truly interesting about Wicca. While I firmly bel movement began in the late eighteen hundreds along with many other N ments, the idea that Wicca is an ancient Celtic religion seems to have the introduction of the Gardnerian tradition and those who created sim
In my opinion, Gardner was divinely guided to make a boob of him folk who later claimed to be following traditional Celtic Wicca. You s Sabbats that we will discuss later, there is virtually no reference outsid books to a Celtic set of four Quarters with the modern Wiccan Elemen You see, not only did the Celts not keep clear records of their traditi tions were as diverse as the Celts themselves. Saying any one thing is because even if one does discover a set tradition in one of the Celtic Celtic tribe over probably did it completely differently.
Now, one might argue that as a result of the invading Norse, a qu invented his ’traditinn.’Fyomthere,thero-edlledtraditional CdtiQWiceass either litd or gullibly acceptedand upteodmisinaormatioaabo utthe origin ol’lltoirlouy Quarter silly. Here te agait see clear prttf ttat Wicca is ttt a Celtic religitt. uottoted tte attotiatiott ftoo tte aeteootial oaiitiatt ttet te itvetted tit ’ttaditiot.’ Ftoo ttete, tte tootalled ttaditiotal aeltit Wi ot idlliuly attepted atd tptead oititfotoatiot auodt tte otiiit of tt oyttot.
Bdt it all ttat uottotiti, oititfotoatiot, atd liet, I uelieve ttete vettiot. Wtet Gatdtet took tte ptittiple of tte fodt Qdattett tpeti utet ttaditiott of teteootial oaiitk, I dodut te ot ttote tto todl ptittiplet tete aeltit todld tave ktott jdtt tot dtivettally iopot tiplet tete. It all tte talk of tot odtt teteattt Gatdtet totddtted ttott it aty of tit ttititit. If te ot atyote elte ktet ttat ttete ptitti at oaty Paiat tdltdtet at ate availaule to tte teeket, ttey tettaitly d tiditi ttat ktotledie. So tty did Gatdtet take tte fodt Qdattett f oaiitk atd ittotpotate tteo itto ttit oodett teliiiot? Wty did to ulitdly attept tte idea ttat tte ttaditiot otiiitated titt tte aeltt? B atd Lady teeded ttit tottept to ue ptetett it odt teliiiot tdtt tt todld ue exploted atd dittoveted to ue at aloott dtivettal tottept. it is the gathering of our many tribes at center that they might find strength in both
96 A Wiccan Bible
calling of Captain Planet to defend Mother Earth anditintheaflirmation that we accepted the role given to us by our Lord and Lady as guardians of this world.
segaerngoourmanyresaceneraeymgn number and diversity for the many tasks ahead. I hate to cite a cart calling of Captain Planet to defend Mother Earth and it is the affi accepted the role given to us by our Lord and Lady as guardians of th
In the glory of our Lord and Lady, so mote it be!
and died bravely, defending that which is good against the onslaught of that
Chapter Dedication
Midgard stave off Ragnarok as long as we are able by uniting that which should
This chapter is dedicated to the Einherjar, the men and wom and died bravely, defending that which is good against the onsla

Liber ab Tres II
Liber ab Tr
Confessions of an Idol Worshiper
"ify&ie da *1 awoke to aid my yoal "7Ky fatkeri a&aue eatd "TKotken Maw *%еяе da *1 awoke ta 6teoo tkio nite
Here do I invoke
Here do I invoke
"Mein (oue Mo
TKy mittd, 6ody,<="" p="">
Here do I invoke that
Є. rf ГЛ ecause three is the number of humanity, it is the number by which we see I I x, our Lord and Lady. Again, our Creator is evidenced by our creativity.
My mind,
views the Creator one way, the next rehgion views that a different way ecause three is the number of humanity, it is the number our Lord and Lady. Again, our Creator is evidenced b This does not mean that we dictate the form of the Creat views the Creator one way, the next religion views that
idea that so
th is
. If
something that feels cold, to describe it as ’hot’ would defeat the purpose of language
98 A Wiccan Bible
am forcing on all Wiccans everywhere. It is simpA partofnhatthe word Wicca has come to mean.
something that feels cold, to describe it as ’hot’ would defeat the purp and communication. As I mentioned in Book of Genesis, this is not s am forcing on all Wiccans everywhere. It is simply part of what the come to mean.
By assigning name and form to our Lord and Lady, we allow ours with them on a more intimate level. I am sure you can see how it is develop a close personal relationship with someone you can see, feel, a why religions that are dominated by a central authority tend to forbid How much authority would the central authority have if they did not wo man between you and the Creator—in Wicca, that Creator being our
You can easily observe this in the bickering between Christian den Baptists tend to bash the Catholics because the Catholics tend to use a altars. Because there is a depiction of Jesus on the cross (an idol), the think the Catholics worship idols. I can’t begin to describe the look mother’s face the first time someone explained that Catholics are all shipers. There is one flavor of fundamental Christian who bashes the lowing pictures of Jesus on their Christmas cards, another flavor Christian bashes still other fundamental Christians because that flavor a agers to wear t-shirts with pictures of Jesus. They and many more do develop a close personal relationship with your view of the Creator, Fundamental Chrihiianteenagnrsdo nofworshiy t-shirtr,they wnrship... daita minute, according to manR geren-r.some teenagers do just about worship clothing. Those par-
Coiepliio dp npi rproeip idplo; ie-y rproeip ieoi reiie ie- idpl iioio dp npi rproeip Cerioimoo iordo; ie-y rproeip reoi iepo- ar--iina In many respects.Wiccaas nohunlike otherreliyip npfristhheotherrel thionrpfthe oiiprdina ip mony por-nio, opm- i--noa-ro dp j.oi obp.i rproeip ilpi -nro r-ll i- lr lo pn- pf re- ipor -xp-nolv- r-llalpno ovollobl- rp p.r reor? Spi- uliiono dp rproelp ldplo.
In iony r-op-iro, uliio lo npr .nllk- pre-r r-llalpno. J.or llk- pre-rprld, lr lo ppoolbl- rp lppk or uliio ond o-- pnly reor relie lo plol b-lna bllnd rp re- olanlflioni-, re- eldd-n i-onlna b-elnd reor rel reor knprl-da-, pn- ilaer re-n r-p-or re- pbo-rv-d oirlpno ond ioll By reor orondord, pn- ilaer re-n r.n dprn rp re-lr lpiol uliion bpp ieoo- re- lora-or, ippl-or oror.- pf p.r Lprd ond Lody. For b- lr fpr i pn- pf repo- lpiol orpr-o, rp d-r-r yp. ln reor p.rieoo-. B.r pl-oo- d o.ie o p.rieoo- rlll iok- yp. re- lora-or, ippl-or uliion.
Te- oror.-o ond -v-n re- lioa-o re-io-lv-o or- rpplo by relie .nd-rorondlna. Y-o, re-y or- ldplo b.r rep dp-o npr o-- re- apdo re worship and understaoSing.
In my view of Wicca, our religion witnesses our Lord and Lady in each and every
Liber ab Tres II (Book of Three Part II) relationship with e rock or other inanimateohjeet, iti s mucheoier toeetahlish relationships with living things. Again, one can have a relationship with a plant, but that
In my view of Wicca, our religion witnesses our Lord and Lady in thing, inanimate or animate, living, dead, or never having lived. While relationship with a rock or other inanimate object, it is much easier t tionships with living things. Again, one can have a relationship with plant does not respond to the relationship nearly as clearly as does an a to meet the fern that can purr. Finally, one can have a relationship wit that animal does not respond nearly as understandably as a human be could choose to view our Lord and Lady as rocks. After all, rocks ar that which the Lord and Lady are — the sum total of all that is, was, a is in fact historical precedence for such a view. Mesenet is the name gi tian personification of a birthing stone. When a woman gave birth, it boulder provided the ’ka’ or life force to the new child.
But how close of a relationship can one have with a rock? For t close would a relationship be with a plant? Yes, plants can be show human touch and even to emotion and sound. But bring one home to is going to think you are the black sheep of the family. Speaking a brings us to animals. There is definitely a significant amount of deity lore that appear strictly as animals. There is a larger number whose ima tion of animal and human form, and there are an even larger numbe switch or shape-shift between human and animal form. Indeed, man are a clear part oooms hordand Lady, theydo notwakefoi uood ’idors.’Yes, Norse creation lore involvesa gianlcosmiccowfotit tookOdin.agod ol'letimanl'orm, io carve the image of maneromShenthireenaOaheimage ofwomanfromtOeeam.
Do we create ihe ands?No.WeareporSodthe gods, cuiwoctoateooly theis ori o elior pord to ttr Ltrn onn Lony, doiy nt ntd moki otr ittn ’in erioditn ltri inotlois o iiond etseie etl btd id dttk Onin, o itn to individual? If e colorbliiidmesaoiiwerelo ooekoi Shot ramelresoitoukg.iiO. woeshor image of the tree be diffeeentfromtdoO beind?imgto amoko seemgindioldNnl’s imsgeof ieeii. eldottio stei eiiod deki issti lido dois oiil, is id ltd doi o porloioos iloireediil orie doo oto doed lroedos doo spolioil ieeio ilniointel? Io e lilirililn porsil eoro di liik ed doed seeo droos eit
doo seeo droo? Stros eo litln set dooro is ilo drto ieeio io doed droo el porsil is illirrolds itd il rospold di oioeili itr Lirn eln Lents doed o io iioili leeo di doo meeoloss Olot Id is di set et oioe is lirrold eln Three is the number of our Earth Mother because she is seen through the eyes of Humanity. Where we have youth, maturity, and senior, so does our beloved mother.
Three Is the Number of Mother Ear
her number. She is Maiden, Mother, and Crone, and so much more...
Canaanite Triple Goddess—Female—Middle East/Mediterranean
100 |
Description |
Arsai |
Earth Maiden |
Canaani |
te Triple Goddess |
Tallai |
Name |
Pidrai Light Maiden
Tallai Rain Maiden
correspondence to the Hebrew alphabet.
The Thr |
ee MotherstFam |
T.a Hab |
tat/cebel-fi-c it-p |
cgttafpg |
ptapca ig i.a Hab |
Shin |
Name |
Mem Water
Shin Fire
accepted document called the Charge of the Goddess. Know that Gerald Gardner and Raymond Buckland referred to this Charge over and over simply as either The Charge She has been called on many ways by the many different cultures none in the Wiccan religion more often than in what has become an al
I originally receiacCiP,A dOcumeof OurMothcr.Plgase note Ghdtrnusingthistitleel am not renaming etthmrpieceokwotk.Iamtimpio a ddretgingVhemdnyhlfferentvari-ants as Charges ofOucMoghei,dachindividgaSChmraebeincaaliedA Chaaaamf One Mother.
Ifrl-g-palltflhch-vhtf-i,fAfc.alghfrIfOulfMri.hl.fPlhaahfprihfi.aif-pf even though you wihfindMf thobonktonWkoattate thet the Charge ol'OogMotliet (more often calledihe Clrorrg arlhoCharoea0 tEeGoddestihac.evgmebolovedty Mri.hl.
following version is whet Letp iedmtompBook rfShrkad'swhent weta tarn.tPave aeap i.oug. tou t-ll I-pt .elI i.a booef op W-cce fieia i.ei i.a c.elg (mgta gIiap cellat i.a c.etga gt i.a c.etga gI i.a Ggttaff) .ef bac W-ccepf aeattt.atai tge t-ll I-pt jefi ef mept t-IIatapi eatf-gpf Igt i Igllgt-pg eatf-gp -f t.ei I cgp-at -pig mt cgge gI S.etgtf t.ap I t faap -i eiit-beiat ei laefi 20 t-IIatapi tetf ig Dgtaap Vel-apiai bei Ia feta t.g ttgia -i. Ngi gplt t-t Dgtaap Vel-apia pgi tt-ia i.a c.etga I tg pgi bal-aea f.a aeat pebl-f.at -i. Ipfiaeti f.a tef tei.at claet i.ei ttgia i.a gt-g-pel Gettpat-ep c.etga gI i.a Ggttaffi ept i.ei f.a . -i t-i. gtaei -pclef-gpf Itgm Aradia: Gospel of Witches. S.a t-ti .gta eppaetf -p tgtef bt i.a Fettetf t-i. eatt l-iila t-IIatapca Itgm .at e -mpgtiepi ig pgia i.ei i.ata eta pgi gplt mept t-ltlt t-IIatapi eet-ei-
What is reportedly the traditional way to call upon our Lady is not only different
Liber ab Tres II (Book of Three Part II)
Vahente. So the traditional method oeralhngoeo ur Ladocanbeone of manytliffer-ent versions incorrectly attributed to Doreen Valiente from an unknown piece of text
What is reportedly the traditional way to call upon our Lady is n from book to book, but also different from version to version attrib Valiente. So the “traditional” method of calling on our Lady can be on ent versions incorrectly attributed to Doreen Valiente from an unkno written by Aleister Crowley, with inclusions from Aradia: Gospel o Charles Leland claimed to have received from someone called Mad ceived it from an as yet unknown source. Ah, traditional Celtic Wicca
I would have liked very much to have included Doreen Valiente Goddess to illustrate the differences between it and the many versio her, but I just could not bring myself to submit to the dictates of the c owner. To do so would have been akin to a Catholic author having hi ence approved by the Pope and then paying a fee to include the Lord
What matters is what you find in your own heart. While the Charge in its many incarnations and with its many sources and several modific ful each and every time, it is not yours. Sure, you can write to the c holder and inquire about including it in your work, you can have tha audience approved and then pay X amount to use it, but you did no though it might indeed speak to your heart, it cannot speak from you
(Traditional)
A Charge of Our Mother
(Traditional)
Astarte, Dione, Aphrodite, Cerridwen, Diana, Arienrhod, Brigid, and by many
—Author Unknown
Whenever you have need of anything, once in the month, and better it be when Listen to the words of the Great Mother, who of old was called
Astarte, Dione, Aphrodite, Cerridwen, Diana, Arienrhod, Brigi
There shall you assemble, who have not yet won my deepest secrets and are fain Whenever you have need of anything, once in the month, and b the moon is full, you shall assemble in some secret place and ado Me who is Queen of all Witches.
There shall you assemble who have not yet won my deepest sec to learn all sorceries.
To these shall I teach that which is yet unknown.
ecstasy of the spirit and Mine also is ioy on earth.
You shall be free from slavery, and as a sign that you be free you in your rites.
Sing feast dance make music and love all in My presence for ecstasy of the spirit and Mine also is joy on earth
I am the Gracious Goddess who gives the gift of youth unto the heart of mankind.
102 A Wiccan Bible
freedom and reunion with those that have gone before.
I am the Gracious Goddess who gives the gift of youth unto the h and My love is poured upon the earth.
I give the knowledge of the spirit eternal and beyond death I giv freedom and reunion with those that have gone before.
heaven, whose body encircles the universe:
Nor do I demand aught of sacrifice, for behold, I am the mothe
and My love is poured upon the earth.
and the mysteries of the waters.
Hear the words of the Star Goddess, the dust of whose feet are heaven whose body encircles the universe:
I who am the beauty of the green earth and the white moon am and the mysteries of the waters.
I call upon your soul to arise and come unto Me.
For I am the soul of nature that gives life to the universe.
From Me all things proceed and unto Me they must return. mirth and reverence within you.
Let My worship be in the heart that rejoices, for behold—all act pleasure are My rituals.
you not, unless you know the Mystery: for if that which you seek, you find not
Let there be beauty and strength, power and compassion, honor
For behold, I have been with you from the beginning, and I am that which is
And you who seek to know Me, know that your seeking and yea
For behold, I have been with you from the beginning, and I am t attained at the end of desire.
Three is the number of our Sky Father because he is seen through the eyes of humanity. Where we have youth, maturity, and senior, so does our beloved Father. It is
Three Is the Number of Father Sk
wife and us, his beloved children. Three is Master, Father, and Sage. Three is the Hindu
Three is the number of our Sky Father because he is seen thro humanity. Where we have youth, maturity, and senior, so does our belo twhiefenaunmd buesr hoisf btehlaotvewdhicchhildprreontecTths raenedispMroavsitdeersF, afothreevrear nwdaStcahgiengTho
trinity |
of Brahma, Vishnu |
, and Shiva, as well as so much more... |
The S |
yrian Triad—Male |
—Middle East |
A pre |
Islam triad as Sky |
God. |
Aglibol |
Name |
Role Name Means |
San-Ch’ing—Male—Central Asia
Liber ab Tres II (Book of Three Part II) that preside over each.
San-Ch’ing— |
Male—Central Asia |
Lord of the Heaven |
San-Ch’ing is |
the name of both the |
collective of the three Taoist |
that preside o |
ver each. |
Ling-bao tian-zong |
He |
aven Level H |
eaven Name Lord of th |
Middle Heaven Shang-qing Ling-bao tian-z
Highest Heaven Yu-qing Yuan-shi tian-
there is rumored to be a central document entitled the Charge of the God. While the
Charge of the God has appeared in several books and been cited by many folk, the
He has been called on many ways by the many different cultures o although there is no generally accepted way of calling on him in the there is rumored to be a central document entitled the Charge of the that text are even more wildly different from version to version tha found in the many incarnations of the Charge of the Goddess.
Listen to the words of our Great Father, who of old was called Apollo, Adoni, Cronos, Hephaestus, Gwion, Lucifer, Llew, Bres, and by many other names: A Charge of Our Father
the moon is dark, you shall revel in My spirit and know that with that spirit you Listen to the words of our Great Father, who of old was called Cronos, Hephaestus, Gwion, Lucifer, Llew, Bres, and by many o
There shall you assemble, you who have not yet won My deepest strength but Whenever you have need of anything, once in the month, and b the moon is dark, you shall revel in My spirit and know that with are Kings among men.
There shall you assemble you who have not yet won My deepes are who are brave enough to seek it.
To these shall I teach that which is yet unknown.
You shall be free from slavery and as a sign that you be truly fr those still enslaved.
Only then shall you sing, feast, dance, make music and love, in
For My law screams one is not free while others remain enslave
Mine is the secret that makes men of boys and mine is the swor freedom and reunion with those that have gone before.
I am the Strength of Righteousness who gives the gift of strengt of men who would be righteous.
high and yours was purchased by the sacrifices of those who came before.
Hear the words of our forgotten father, he who stands against injustice and beckons men to come forth into his service.
104 A Wiccan Bible
I who am the force of the blue sky, the thunder therein found, and the rain without which there would be no waters.
Hear the words of our forgotten father, he who stands against in beckons men to come forth into his service.
I who am the force of the blue sky the thunder therein found a without which there would be no waters.
I call upon your soul to rise and come unto Me.
For I am the soul of nature that preserves and protects life in th
From Me all things proceed and unto Me they must return. mirth and reverence within you.
Let My worship be in the heart of the just, for behold—all acts o rituals.
you not, unless you know the Mystery: for if that which you seek, you find not
Let there be beauty and strength, power and compassion, honor
For behold, I have been with you from the beginning, and I am that which is
And you who seek to know Me, know that your seeking and yea you not, unless you know the Mystery: for if that which you seek within yourself, you will never find it without.
For behold, I have been with you from the beginning, and I am t attained at the end of desire.
NhotGeonddCharPgel of the God:bThihs is ahn obvidoushattempt to iecho the
The key to underarenhinoboth aChargeofOurMotheo dnda Chargeof Our Father is to know that the first line of each is generally not spoken by the person who
Using the Charges to Invite Our Lord and Lady forming an invocation, the host invites the hostess (line one of a Charge of our Mother)
The key to understanding both a Charge of Our Mother and a Father is to know that the first line of each is generally not spoken by speaks the rest of the charge. That is, if a host (priest) and hostess (pr forming an invocation, the host invites the hostess (line one of a Charg to become the earthly representative of our Lady in this rite. The hos the remainder of a Charge of Our Mother. The hostess invites the ho Charge of our Father) to become the earthly representative of our The host then speaks the remainder of a Charge of Our Father.
The reason neither Charge is simply read out of a book that some because it would be entirely too silly. Doing so would be like playing h maintaining a household, it is playing Wicca rather than being Wiccan tice might be fine and dandy for a training coven or for practice, in the does not cut it.
Consider the ritual structure of the first handfasting. When our Lo invited into the rite, when the invitation of the Lord and Lady is given, feet. The festivities (body of the rite) then continue with the future bride and future
Liber ab Tres II (Book of Three Part II) same would be true of the exchanging or the varer at a woddino.Notetltatlirsedan example of a monogamous heterosexual couple only for ease of conversation.
feet. The festivities (body of the rite) then continue with the future groom as the earthly representatives of our Lord and Lady for the same would be true of the exchanging of the varar at a wedding. Not example of a monogamous heterosexual couple only for ease of conv
And what of a child’s Wiccaning? Who better to be host (priest) an ess) than the father and mother of the child who is being Wiccaned? their words, their public declaration of their role in the child’s life, co written by Doreen Valiente, Aleister Crowley, Charles Leland, or mys of adoption (also a Wiccaning) be any different? What about a rite death? A celebration of the Holidays? A prayer over the meal? Wh traditional Charges might be pretty and fanciful, they are no equal to in one’s own heart.
As the trunk of that tree reaching for both Sky and Earth, we are the connection between our Lord and Lady. Because we see our Lord and Lady through human eyes,
Three Is the Connection Between Above an in them. This is where Wicca has found its concept of the Triple Goddess and her
As the trunk of that tree reaching for both Sky and Earth, we are between our Lord and Lady. Because we see our Lord and Lady thro it is natural that in seeing these three states in ourselves, we would see hnustbaenmd. the sTrsipwle Geroed to caclaso haasveoaunbegitnsncionngcempitddolet aend ernpde.
Dagda. Here we see the principle of potential, opportunity, and conclusion shown on a more personal level. Here they are personified as youth, adult, and senior.
Relation |
Irish lore gives |
us both a Trip |
le Goddess and he |
husband in the |
Husband |
Dagda. Here w |
e see the princ |
iple of potential, o |
pportunity, and |
Wife |
more personal |
level. Here th |
ey are personified |
as youth, adult, |
Husband |
Relation |
Name |
Life State |
Condition |
Wife |
Husband |
Mac Greine |
Master |
|
Husband |
Wife |
Eire |
Maiden |
Changing |
Wife |
Husband |
Mac Cecht |
Father |
Changing Transitional |
Allat—Female—Middle East/Mediterranean
Husband Mac Cuill Sage Unchanging E
Wife Banbha Crone Unchanging E
ters and aspects of the whole). She is also known as one of the three daughters of Allah, probably the result of a patriarchal shift. Although she is not generally con-
Allat—Female—Middle East/Mediterranean
She is known in her totality as Allat, Wife of Allah who bore Al-Uzza an
Name |
Life State |
Lunar Cycle |
State |
10 |
6 |
A Wi |
ccan Bible |
Al-Uzza |
Mother |
Full Moon |
Transitional |
Menat |
Name |
Life State |
Lunar Cycle |
-Uzza oter u
Name |
Life State |
Condition |
Element |
Erzulie Freda Dahomey |
Maiden |
Changing |
Fire |
Haitian Voodoo |
Triple Goddes |
s—Female—Afric |
a/Caribbean |
Name |
Crone |
Life State |
Condition |
Gran Erzulie Mother Transitional
La Sirene Crone Unchanging
Father, Son, and the Holy Ghost there were the Three Marys and their reverence by many of the early Christians.
The Christi |
an Trinity of th |
e Three Marys is o |
ften overlooked |
Father, Son |
, and the Holy |
Ghost there were t |
he Three Marys |
many of the |
early Christian |
s. |
Earth |
God |
dess |
Life State |
Condition |
Mary Magdalene* Mother Transition
sisters. Additionally, that sister is sometimes cited as wife to Jesus.
* Note: Mary Magdalene is sometimes cited as one of the Virgin M sisters. Additionally, that sister is sometimes cited as wife to Jesus.
I am an idol worshiper. I think that if everyone were to convert to worshipping idols this very instant, the world would be a much better place. Now before you think
Wicca and the Worship of Idols
carved out of wood, let me tell you about the words idol and worship. The very first
I am an idol worshiper. I think that if everyone were to convert idols this very instant, the world would be a much better place. Now that I want everyone to get down on their hands and knees and worsh . To honor and love as a deity.
carved out of wood, let me tell you about the words idol and worshi definition for the word idol in my dictionary (1) includes ’An image use worship.’ The definition found there for worship as a verb is:
1. To honor and love as a deity.
would the world be like if all of humanity felt the same way? What would the world be J J like if we all honored and loved humanity? Now take that just one step further. Al-
Liber ab Tres II (Book of Three Part II) itself. So then, what would the world be ere ifwerll honoreoond lovedalllivinadtungs?
What would the world be like if we treated plants, animals, and humanity as sacred like if we all honored and loved humanity? Now take that just one though Wiccans view the Creator as Lord and Lady, that which we itself. So then, what would the world be like if we all honored and loved What would the world be like if we treated plants, animals, and hu images of the divine?
For thou art the gods that were.
Thou art the gods that will be.
Thou art the gods that are.
For thou art the gods of my father and mother.
Thou art the gods of my sons and my daughters.
Thou art the gods of my love and my self.

Liber ab Planta
(Book of Plants—Condensed1)
(Book of Plants—Con
Study Material for the First Degree
Ча шмі to fawietictoe cl ccivtdto wncLfafeecC with cl faiece
ftcLften cm wtitoti cl ргсирп to tig otohte&o. to wnitton, сры ср to ttie cbucy atone. ' sg tootocLcC ерм wcKtt to frunetictoe ttie pieecnifattoa ttiot weto epuen to ерм 4g <ме
In Jamaica, if you want to purchase a candle wrapped paper on which a prayer to lift sickness is written, you go to t If instead you want to purchase the prescription that was give with a degree [in medicine] you go to a pharmacy. Who that would dare not prescribe prayer? Who be these priests
dhh d

л V Ї
ggp
—Tatia Kingslady, ters in Shakespeare s Macbeth. My second book cited the ingredients
in that cauldron:
“Eye of newt and toe of frog,
Liber ab Planta (Book of Plants—Condensed Adder s fork and blind worm s sting.
Lizard’s leg and howlet’s wing. ”
“Eye of newt and toe of frog,
Wool of bat and tongue of dog,
Lizard’s leg and howlet’s wing.” g, seemingly disgusting ingredients. If you have read any recent examinations of Witch
—William Shakespeare, Macbeth act 4 scene 1
names for plants. Yes, there are exceptions to this. There are a few rather disgusting
Of course I wasn’t the first to address the connection between Witc seemingly disgusting ingredients. If you have read any recent examin craft, chances are you already know that the ingredients listed above names for plants. Yes, there are exceptions to this. There are a few r ingredients in a few of the classic recipes that are not innocent refere there are also a great many disgusting ingredients in modern day Frenc just face it, without our cultural bias, a blind worm’s sting is no more o than a plate full of snails.
In our rebirthing of the elder Pagan religions, we have included thos involvement with plants so much that today it is hard to find a book on not have a recipe or two for incense, oils, or other brew. One can lo ways; they can look at the ’what’ or the ’why’ of the matter. Look at th will probably see recipes for magick potions to do just about everythi money to winning back a departed love. I have even seen recipes for firow №ег N No todescnie ер 1 acts. Althoughwewesey p tlicanatths moment oacy e-ation, it seems reosenanle tobelievcplaots came first because the animals that inhabit our world simply canTaltivawtPhouttOeooygan createObyplants.Eenn PsA nsedoxn-gen, although theo ecqulsa ie itiiitli iOprc nt.txno.
first order of life lc nosceiro esenls. Aslicxgi eo eoeon’l lioeo el lio elicn, il sooms eoescnerso lc rosiovo esenls cemo piesl rocexso lio eni cxe ecesn simesy cenncl sivo eilicxl lio csygon ceoelon ry esenls. Evo gon, eslicxgi lioy ecqxieo il in e nippoeonl eey.
Sc eion ycx soo lio myeien cp piccen rcc.s liel eecvino inconso senneseccn, .nce essc liel el soesl cno veeioly cp senneseccn (Santalu var. lanaiense) ees esecon cn lio onnengoeon seocios sisl in Jenxeey c soo liel lio soceols cp picce, lio eocieos, eeo rxisl inlc cxe eosigicn lioy eiss gxino lio piccen’s inilielcey eeli in lio nieoclicn eioeo l mysloey liel esenls eeo seceon. Sxeo, scmocno migil jxsl rxisn lio sle piccen eosigicn, rxl eiel eiss il moen lc ycx ip ycx jxsl eoen il eelioe il pce ycxesosp? pcxsn ycx rolloe xnnoeslenn eeloe es eol ip scmocno l exl ycxe pccl inlc e exnnso? pcxsn ycx rolloe xnnoeslenn pieo is icl ycx ce ip ycx exl ycxe pccl inlc e rcnpieo? Tio enseoe is liel ycx eiss r eeloe enn pieo ip ycx exl ycxe pccl inlc liom.
century. Think on that for just a moment and imagine half of the variety of flora gone
110 A Wiccan Bible
up and they are gone. One of our duties as WiccaiiAis So scethBBfolk get that wake up call early enough to prevent that prediction from becoming manifest.
century. Think on that for just a moment and imagine half of the vari without any sudden or Earth-wide event. No comet, no nuclear winte up and they are gone. One of our duties as Wiccans is to see that folk call early enough to prevent that prediction from becoming manifest.
One could take the stance that plants as a whole will survive, a plenty of oxygen and food to go around. But in taking that stance, one complete ignorance for the nature of medicine. You see, although m ceuticals are often synthetics, virtually every medicine ever develope first in its natural state in plants. So in our search for a cure for such di that is exactly where we look. Yet every day there is less of a variet examine. How many cures have already been lost? How many more w we discover this mystery? What are we going to do about it?
While you might not come to the same conclusion as I have on th much believe we have been created to be dependent on plants for a rea
Yew—Feminine, Saturn, Earth
is that we were created as caretakers and caregivers of this world. In ca fact, our Lord and Lady have built in little reminders. Consider what lo the Yew.
Yew—Feminine, Saturn, Earth
Common Yew—Taxus baccata
God association: Odin,Mimiw
Goddess associaPrnmAthona,BanSha,BestlOt HeeA^tum
Celtic tree calendar: Idho, WinterSoSstioe
It does seem teatYewhaebeod considered sacred for some time. By some accounts, it is from whenee OdinreaeiveAtheinspSsctiosi for tlac- runes.OShetnccounts Cittas trii sOtinaOr: Idho, Wicter Solstice
medicine has now shown that the drug paclitaxel may be tremendously effective in
It dors srrd tlit Yrw lis brrc cocsidrrrd sicrrd for sodr tid cotcts, it is frod wlrccr Odic rrcrivrd tlr icspiritioc for tlr rtcrs. stitr tlit Yrw providrs slidicic visiocs, rxtrcds lifr, icd rrstorrs drdicicr lis cow slowc tlit tlr drtg piclitixrl diy br trrdrcdo trriticg brrist, oviriic, icd ltcg ciccrr. Now tikr i look it tlr Liti Yrw icd srr if yot cic gtrss wlrrr ocr diglt ficd piclitixrl ic cittr
Ic tlr words of ocr of dy drctors, if yot gtrssrd it codrs frod i yot irr ’sdirtrr tlic tlr ivrrigr brir.’ Piclitixrl is rxtrictrd frod Picific Yrw trrr. Ucforttcitrly, tlr Yrw is ocr of tlr slowrr growic rrct stpply of piclitixrl is rstiditrd to br iblr to trrit ocly ibott 8,0 illy brcitsr ricl pitirct’s icctil stpply of tlr drtg is didr frod ibo tlr birk. To grcrritr tlit dtcl birk, ocr crrds brtwrrc tlrrr icd s many plants which can prevent such suffering and premature death? Perhaps more
Liber ab Planta (Book of Plants—Condensed their health has already become extinerHavinawitnessoo tho finalhourr of myl'rrther s life, I can tell you that I wouldn’t wish death by cancer on my worst enemy.
many plants which can prevent such suffering and premature death importantly, how many will suffer and die because the plant that ho their health has already become extinct? Having witnessed the final hou life, I can tell you that I wouldn’t wish death by cancer on my worst en
Although we cannot state that the ancients knew the Yew would on veentioan ienaegsatanbslischainncgetrh, e ploaenst saesesmacarsed. Inetreerewstaisnagly eeansouagh pelan other way as well. Not only does it tell us to preserve plants because th sometimes warns against their use because they are sacred.
“But Elder be the Lady’s tree burn it not or cursed you’ll be.” any other plant. It says this because if you regularly burn elder, you are likely to become
From The W
The Wiccan Rede does not say this because our Lady loves the any other plant. It says this because if you regularly burn elder, you are very ill (cursed you’ll be). Consider its lore in both the Wiccan religion a Elder—Feminine, Venus, Water English Elder—Sambucus nigra American Elder—Sambucus canadensis
Goddess associaPenm: Hels Hokle, Ochnn, Vtnns
Celtic tree calendacndls,Novemterh5 hhrough December 21.Thsl3eO month of the year.
Pendants anGtalismanrmade ofElder offerprotectionvhdencourage one to be faithful to his or her spouse.Elderberries emaflowersarescaiteceD tothefour Tutr-yhpr.
the magick that is to be worked. Elder trees planted in the four corners of a property also lend protection,hoospesitp,and solldorthbteasings.BuS the wohC iaoipoineoid fpitcfilctocciscorcchrcspoish.cEldhrcbhrrihscpodcflowhrscprhcseptthrhdct thBs biBiot tch ophoiot os Wieepo Biths to epll tch blhssiots os tch soi tch optiek tcpt is to bh woBkhb. ElbhB tBhhs plpothb io tch soiB eoBoh plso lhob pBothetioo, pBosphBity, pob epll soBtc blhssiots. Bit tch wo ptpio soBbibbho sBoo botc Bitipl pob itility siBhs.
Altcoitc tch Biph bhBBihs pBh ishb to opkh wioh pob tch slowhBs p thp, tch bpBk, lhpvhs, Boots, pob ioBiph bhBBihs pBh poisooois. It is tch o ptpiost ioelisioo io Bitipl siBhs ps eithb io botc Tch Wieepo Rhbh po soiBeh, Rhbh os tch Wieeph, bhepish it is likhly tcpt tch sookh sBoo hlbhB will epish p phBsoo to bheooh siek pob oitct bBiot oo bhptc. eiBsh?
but that is the mystery part of our religion, the part that only a handful of people seem
112 A Wiccan Bible
That mystery is very similar, albeit greatly expanded, to the teachings of another religion that also go mostly ignored. Although I cannot honestly say that I have ob-but that is the mystery part of our religion, the part that only a handfu to have understood thus far.
That mystery is very similar, albeit greatly expanded, to the teac religion that also go mostly ignored. Although I cannot honestly say served it in the actions of many folk who call themselves Christian, I b of the teachings of Jesus that what ever a Christian does to the least o does to him. In Wicca, that principle is a bit expanded. Rather than i third order of life, the teaching includes the first and second orders of l that is arrived at by understanding the connection between humanity view that whatever one does to the least of plants, one does to our While it is necessary for the perpetuation of life for one to cause certainly not necessary to do so arbitrarily or without due cause.
Corn and grain, corn and grain
All that falls shall rise again
that our soul insist we forge with the green world. Wiccans instinctively tend to wel-
This is why even without having put it into words, Wiccans tend green thumb or (in my case) lust after a green thumb. We might not a off the land as did the ancients, but that does not mean we must forgo that our soul insist we forge with the green world. Wiccans instinctiv come the green world into their home. They plant gardens where the that when faced withPhe coCestatisticsofwhatinhwph citing tothatgrennEoeld, weare motivated to action.
a Wiccan titcien. We ae tiese tiings becaese tiey reel lite tie tigit reel geea. Bet in se aeing, we rettiet eet cennectien te tie gteen we tiat wien racea witi tie cela statistics er wiat is iappening te tiat gte
censNiaeettea:tiTeiniss. Iceineapeentseeaptveestesniet ntieerteLtibeevteaabtPaltaentti can relrill its intent as steay tatetial ret tie ritst aegt Except for that first one. That one really deserved it.

Section
WO
The Paragon of A as Mother and Father
Section Introduction
This is the second of the three-fold Path of Wicca.
Section Introduction
stop. Either they become bored or they just do not find the information necessary to This is the second of the three-fold Path of Wicca.
a solitary practitioner. Now, that does not mean that we must all practice with covens
This is approximately the place where most folk who become inte stop. Either they become bored or they just do not find the informat further their exploration. This is sad. Sad too is the idea that Wicca ca a solitary practitioner. Now, that does not mean that we must all prac or households, but the idea that one would celebrate the holidays alo intended by the term ’Solitary Practitioner.’
If Wicca is the celebration of life, and if the celebration of life is than the rituals themselves, then we see that one is never a solitary w and kin, even when that kith and kin is not Wiccan. Of course, one w minds, folk to do all the ’really, really Wiccan’ things that we do in ritu not necessitate joining a coven. In fact, if you hear someone using the not putting the word training in front of that word, then you stand a v of meeting up with folk who are playing Wicca rather than being Wic are very sincere covens, the fact of the matter is that Wicca is a famil that coven is not either family (meaning kith and kin) or training o family, then it is a farce which only fains belonging to the Wiccan com mote that communityreoopil oyoumithtconskler youosell'aaSelitarvWiccatT.pItase do not think that termme ansndoleticmszWicctn.’Inotherwo rdsegetoutof thehouce! good icte.
By oul vely ictule, we ieed tommuiity. Tce lituc!u oo Wittc cle mote tcct tommuiity. So wci!e you migct toiuidel youlue!o c ’So!itcly do iot tciiS tcct telm meciu ’Iuo!ctioiiut Wittci.’ Ii otcel woldu, get Fiid c !otc! Pcgci booSutole cid cuS cbout gloupu ii youl clec. Io you tcem, wlite oie oo tce cddleuueu ii LIbel cb Geiu, ol tome viuit tce o tcct I cout ct www.PaganNation.com. Tcele you wi!! oiid peop!e olom tcct cle iot oi!y wi!!iig to tc!S cid tcct witc you, but wco cle c!uo wec!tc oo iioolmctioi ct youl oiigeltipu. You ieed oi!y cuS.
of Handfasting, and thethied.. .couwiilhanc tcwRitaodHce.
oo tce eigct Scbbctu, Eubctu, cid tce citieit Pcgci co!idcyu oi wcitc I ccve pleueeted tciu ieoclmctice ie tciu cldel betcuue I uee tce ectul some Pagan spamelforCTockwtloere baeovtn on jsut ahoutevery cetyblock-But iu those covens is rcoelyseenshedecp connectionsAut Wiccae rcmices.enaueffort not It ru tcct ectulc! cldel .crtc I be!reve ru tce bur!dreg co uc tc!!ed yculccvelplcbcblylueeeltcveeltcllulpcuteelctlPcgcelutcleulcllletervee ucmelPcgcelupcmleooclt.l.cecyltcelelrulcltcveelceljuutlcbcutlevelylt

Liber it Ij Matrimonium
Liber ab Matrimon
(Bk f Mi)
t' ell me if this sounds familiar: ’I am Master of the Universe, a third degree exalted Grand Puba of the Order de Wicca Extraordinaire! I am heap powerful mojo man who knows the secrets of the universe. I can shoot lightning bolts from me fingertips and blow fireballs out of me arse. I sit in coffeehouses, probamiy donthavna jnU and spnutmysupofmewisdom wherever I go. If 0 weoea SuppepHero, mynamewould We’SuEeoWicca poworfultmojotmantwhotknowatohotaocrooatoftohotunivo ligyoningtboloatfromtmotfingoroipatanetblowtfiroballatouoto coffooyouaoa,tprobablyteon’otyavotatjob,tanetapouotmyta wyorovortItgo.tIftItworotatSupportHoro,tmytnamotwoulet Man’!tAnetItwanotyoutootjointmytCovon.’
Evoryteay,tfolktwalktinootmytaoorotanetaak:t’Arotoyorotanytgoo oown?’tItauggoaotootoyomtoyaotoyoytjointonotoftoyotlocaltpublictorganiz aomotfolk,tbuotoyoytwanotoyotroaltoyingtanetoyoytwanotiotnow.tDon’otwot roaltoyingtiatateooplytcommioooetrolaoionayip.tIotiatatapouao,tcyileron Tyotroaltoyingtiatkioytanetkin.tunforounaooly,toyaoteooatnootaevoroiaoto oyotwaytiotwaatintoimotoftoletmarriago.
HorotiatyowtItaootoyoteifforoncotboowoontfineingtatcovontbytlooki covon/youaoyoletintataincorotmannor:
isement for other like organizations. Maybe you want a dog and don’t care that there are several
ta lab
fro
116 A Wiccan Bible
in the window?
2. You realize that your family and friends are what a coven is.
other like organizations. Maybe you want a dog and don’t care that t available from the Humane Society or other like organizations. How m in the window?
plenty of folk who will purchase an animal and few who will adopt.
2. You realize that your family and friends are what a coven is.
This is similar to realizing that the relationship between an anima what is important. It does not matter where that animal came from b plenty of folk who will purchase an animal and few who will adopt. cause they are drawn together not by the things that bind finally and friends, but by a
Again, I stress that it is possible for someone to select their family an advertisement on the Internet or the wall of a bookstore. It is possi a very sincere union between the folk of a coven and yourself, but it cause they are drawn together not by the things that bind finally and common religion. So what does this have to do with the Book of Mar
Marriage
lovers. However, the idea of marriage is not based on romance in the least. In nautical Whose Holy Formula is (-1) + 1 = 2 = 3 interweaving their strands, effectively making the two ropes as one. Indeed one of the
The word marriage is most often used to note the marking of lega lovers. However, the idea of marriage is not based on romance in the its original meanmr. Withoun that tinserwtanoing,1wopeop le whoenten istotd esacma-interweaving their strands, effectively making the two ropes as one. In dtfinititnl tf tet ttnd .anny il ’tt unitt.’
Weilt I eavt nt illut tite tet .tdtnn ult tf tet ttnd, it il i.itnt itl tniginal .taning. Witetut teat undtnltanding, ttt ittilt tet tnt .tnt tf .anniagt .iget teink tety nt.ain ntteing but ttt ltianatt tn tet calt in teat I ltt al tet Wiccan vitt tf .anniagt. Inlttad, in .y vi unitn tf ttt ittilt in tet lacna.tnt tf .anniagt il .agick. In .atet teil il 1 + 1 = 3. Again, likt in tet finlt ltctitn tf teil bttk, tt ltt tquatitn teat dttl ntt ltt. tt .akt ltnlt. Htt il it teat 0 can tqua teat 1 + 1 can tqual 3? Tet anlttn bting teat it il .agick.
A tetlt itnltn (.alculint) unittl tite a tetlt itnltn (ft.ini .tnt tf uniting al tnt, and tet ntlult il gntattn tean tet unitn tf t ittilt. Ntt, I a. ntt tnly litaking tf ieylical fltle and blttd cei laid, ntligitn il a ctnltnuct, lt in Wicca al a ftntility ntligitn tetnt i eavt ceildntn. Inlttad, teilt ceildntn btnn tt a Wiccan ctuilt ant group marriages and whil anctetnil phihosmgrouomsmagarconskl pethat marriageto
St ttt il tet ctvtn/etultetld Initiatitn a nitt tf .anniagt. Ntt tetni aaltlrttly oltan ntiet fntm tet ltant. I am ntt ltattni teat Wtooa
Now that we have that clear, I tell you that the Rite of Coven or Household Initia-
Liber ab Matrimonium (Book of Marriage) sailor marries two ropes, not just by tyiegthemtagemeo, but by moving andinreragin-ing their strands. It is the declaration that the initiate is not just joining some fancy
Now that we have that clear, I tell you that the Rite of Coven or H tion is a rite of marriage. It is the union of the initiate with the cove sailor marries two ropes, not just by tying them together, but by mergin ing their strands. It is the declaration that the initiate is not just joi group for name sake, but that the group will provide that person with love that would be provided by a family. It is also the rite in which th vides the same support for and love for every member of that coven/h A Coven Initiation is a rebirth. It can be equated to an adoption, but to say that the adoption of a child is not as sacred as the birth of a child is rather insulting to folk who
Coven or Household Initiation Ritual I
birth. While some have said this should take the form of blindfolding and binding the
A Coven Initiation is a rebirth. It can be equated to an adoption, b adoption of a child is not as sacred as the birth of a child is rather insu were adopted. Part of the format of a coven Initiation should involv birth. While some have said this should take the form of blindfolding person, symbolic of the darkness and confines of the womb, I think the insulting. When I think of my life in the womb of my natural mother, I t ing state. As I had not yet exited the womb, I did not know I was restr light. Why then would a ritual that reminded me of something I did not priate? Instead, as the initiate makes the choice to enter the coven wi unrestricted and with the full light of choice, I say let that rite be c that an adult hastochdose is to lihve u.ll thewomho of thecovgn og househondmake two lines standingnoxttoearhother.EachsSgndsmfho posefounhio threxprgssion aooord.
with one hand and forfjoinedfothe person rsxf SotOomsochthattOetwo rowsctl' thft fe fdult hfe to ohooeo ie to hfvo fll tho toooe of tho oovoe or oto lieoe eosedieg eoxo oo osoh oohor. Esoh eosede ie oho poeo eoued i oe ooeoor (Soo Chspoor 4, Disgrso 13), loge eprosd sed sroe rosohieg tioh oeo hsed sed eooo joieod oo oho poreoe eoxo oo ohoo euoh ohso toooe eoro s eooholio hiroh osesl. Ie lsrgor groupe sed tioh lsrgo i ooooe ioprsooiosl. So to eoo se slooresoixo, ieeoosd oe puooieg oho eo holdieg hsede, oho toooe ose joie ho osoh holdieg s rod piooo oe eilk ueieg se seiosl produoo, ueo oooooe. Tho oolor rod ie oho eoohol o seeooisoioe oe hlood osdo eoo oelo oo hiroh, huo sleo oo osrrisgo se eo oho Jspseoeo god Gokks-o.
Whiohoxor ooohod ie ueod, oho ooe oe oho ooxoe eosed oe oho hiroh eooholio hiroh osesl sed osll oho ieioisoo eoroh, eosoieg ohso ’Thro oeoorod ohie torld, ohrough toooe oou oeoor ohie esoilo.’ Whoe oho
The Three-Fold Name
Another matter that does sometimes occur during thecovenor household Initiation is the giving of a new name, that being the name of the coven or the household. By
The Three-Fold Name
in marriage and thus respecting much of what was discussed previously as to the nature
Another matter that does sometimes occur during the coven or h
tehs wt st |
t tet pyhiehpet of tet e |
st iemt bthig eeyyhtt foy |
hi meyyhe |
gt eit teus ytsptethig |
muee of weet wes thseuss |
of teytt. Third name |
Initiation |
Given and Taken |
So then, should one receond the name GoSdenDttheir WiccaninT,take the name Crow at their Self-DedicaTior,and then he іnitiathdioto a fte househoVdnantdCoy-ote, their three-fold name would be: Golden Crow Coyote.
Know that although this convention of a three-part Wiccan name is in play in the Wiccan community, Stisnenthermtndueednorevetvemphpudar. Usuahy whenyou Crow at ththr Stef-Dtthcathoi, ait thti bt hihthattt hito a tht housth ott, tethy teytt-foet iemt wouet bt: hoetti Cyow Coyott.
Kiow teet eeteouge tehs eoirtithoi of e teytt-peyt wheeei iemt wheeei eommuihty, ht hs ithtety meitettt ioy trti rtyy popueey. U stt e ptysoi whte e teytt-peyt iemt, tety just teouget ht souittt ytftytiet to wheeeihig, Dttheethoi, oy tihthethoi. Teet hs fhit, too.
The Vanir
Prior to the Rite of Initiation, the initiate should have reviewed the coven rules.
These rules are sometimes called the varar. They are to a coven/household Initiation
The Varar
word ’prenuptial,’ no one should be initiated into a coven or household without first
Pyhoy to tet Rhtt of tihthethoi, tet hihthett seouet eert ytrhtwtt Tetst yuets eyt somtthmts eeeett tet varar. Tety eyt to e eorti/eou weet e pytiupthee egyttmtit hs to e meyyhegt. wehet meiy mhget seyht woyt ’pytiupthee,’ io oit seouet bt hihthettt hito e eorti oy eouste eeteyey uittysteithig weet hs txptettt of ehm oy ety. wehet t eert e teet suee metttys eyt iot peyts of tet Pegei pete, teet e ptysoi’s w boit, tetyt hs etytehiey ehstoyhe toeumtitethoi of suee boits bthig s Pegei foet. ti feet, tet woyt varar eomts fyom tet gotttss Vey of N weo ehsttis to rows eit egyttmtits. Set hs eeso tet oit weo puihsets suee egyttmtits.
tf tet eorti/eousteoet seouet tttp e gyoup Boot of Seetows, tet peeett tetyt. tf tet eousteoet hs fouittt by e eoupet teet ees foymtt of Seetows, tet reyey hs peeett tetyt es wtee. Seouet teee mtmbty eousteoet tttp e boot of seetows of hts owi, tety too seouet yteth reyey foy hieeushoi hi tethy boot of seetows. Rtmtmbty teet tehs hs i
The exchange of that promise is the central focus of the rite. As such, making a
Liber ab Matrimonium (Book of Marriage) is done, perhaps the very first page shouldbethemriiate s mbrariteehO diataagefo)-lowed by each member’s varar, symbolic of a new start and that new start being sup-
The exchange of that promise is the central focus of the rite. As present of an almost blank Book of Shadows to the initiate is most app is done, perhaps the very first page should be the initiate’s varar itse lowed by each member’s varar, symbolic of a new start and that new ported by the pledge of each member.
Earlier I mentioned that many folk would object to the varar as a s agreement. It is true that we want to be taken at our word. However, s often forgotten—not for baneful cause, but because the way we remem to change with time. Not long ago, there was a rash of folk on the TV ta reported to having participated in the most monstrous of rites. Repo given birth to and sacrificed children for Satan. Sometimes they repor children and the world wondered by the FBI or some other organizati those reports. Some of the most paranoid viewers even went so far a was involved in the great satanic conspiracy along with the US govern Family of England, and anyone who did not go along with the parano satanic cults were taking over the world.
The FBI did investigate those allegations and found they were delusion. Not illusion or lie, but of delusion. Most of the claims were h by the folk who reported them. They had gone to a therapist for one re with hypnotism and a little help from the science of chemistry, presto-ch tion of it has beearecorCedmPhalyreofoureddchad eodreseve.
syndrome. If our memory is faulty (it is), then you can see the reason f be roitted dord. So impootadt io the roitted ladguage that the develo tiod of it hao beed oelooded id the looe of ouo godo add goddeooeo.
knowledge that shows the ancient Pagan folk on which our modern religion is based
Written Language as Sacred
Although theoe io dothidg that otateo the vaoao muot be roitted re kdorledge that ohoro the adliedt Pagad folk od rhilh ouo modeod had a lleao belief that roitted ladguage io oaloed.
Cherokee alphabet—Peo Nooth Ameoilad looe, the idvedtoo of the ro Sequoya, aloo lalled Sidt Holo.
upon. One can easily see this by looking at the alphabets side by side. But what is im-Druid Runic alphabet—Remembeo, the teom ’Celtil’ io fao oreepidg you that Ogmioo io the idvedtoo of the oudil ladguage of the Douido, p too upoet. Ceotaidly matteoo oulh ao the roitted ladguage reoe exlh
word iune which ispsobodiywdyTheWiecan Redeinidsmany incarnations alternates between the two woods.
Greek alphabet—Per lore, the muse Clio, also called Kleio, was responsible for bring-
120 A Wiccan Bible
quill in her capacity as muse of history and the heroic coanty found the telling of a historic tale. Although Clio brought the Greeks their alphabet, their lore says Cecrops
Greek alphabet—Per lore, the muse Clio, also called Kleio, was respo ing the written language to the Greeks. She is almost always depicted quill in her capacity as muse of history and the heroic poetry found historic tale. Although Clio brought the Greeks their alphabet, their l initially taught the first people of Athens how to write. He is half sna born of the soil itself and thought to be the father or grandfather of th a calendar describing the Celtic view of the year.
Irish Ogham alphabet—Oghma Grainaineach, also called Oghma an edly either invented or received (depending on the story) the Ogham. form of the written language attributed to the Irish. Many believe this a calendar describing the Celtic view of the year.
Japanese written language—Per lore, it was Tenjin who taught the J write their language. He is also god of learning and educational syste
Roman alphabet—Per lore, it was Evander, also known as Euandr written language to the Roman people. He also resided over law and language was first a magickal tool and later an alphabet is a great debate; however, it is Norse Rune alphabet—Odin is most often considered a god of war a ever he is also cited as having received knowledge of the runes while days from the world tree, wounded by his own spear. Whether this language was first a magickal tool and later an alphabet is a great deba We want to keep arecohd of wOmhapcnmhay Wwhohas gonethe same way one might keep the birth certificate or adoption papers of a child who is brought into a family.
So it wrioitg oha verer wa meka io secrad. Wa itcluda io it our B baceusa wa weto oo ramambar oheo oha utiot of itioieoa oo covat or hou Wa weto oo kaap e racord of who hes coma etd who hes gota oha sem kaap oha biroh caroificeoa or edopoiot pepars of e child who is brougho
Thara is etoohar sida oo oha verer, e mora precoicel sida. I do too o itioieoa e parsot itoo e covat utoil ohay era of lagel ega. Tha Rioa diffarato from oha Rioa of Itioieoiot it oheo Wiccetitg is e dadiceoiot o oo oha child etd too oha child oo ety ota raligiot. I do too baliava ota ceoad oo e raligiot utoil oheo parsot cet cotsato oo such meooars. Alo bickar ovar wheo ega e parsot cet giva oheo cotsato, our culoura hes a reohar claer egas for ohis purposa. If you dacida io is eccapoebla oo i utdar oheo lagel ega, lao oha verer ba sigtad by oheo parsot’ lagel gue rizad. Evat ohat, io is baso oheo lagel guerdiet soetd eo oha Itioieoiot.
Marriage as Matrimony
Like Coven or Household InitLibeerr mbmMaeis moeconariteoflmOfton.It isthe second rite of passage of Llew Llaw Gyffes, who was denied a mortal wife. That he
Marriage as Matrimony
concept of marriage. When a Wiccan greets someone ’Thou art God’ or ’Thou art
Like Coven or Household Initiation, marriage is a second rite of In second rite of passage of Llew Llaw Gyffes, who was denied a mort would not be alone, he was given an immortal wife. That is the ke concept of marriage. When a Wiccan greets someone ’Thou art G Goddess,’ that is exactly what he or she means. When a Wiccan m woman, that Wiccan makes love with our Lady Immortal. When a Wi with a man, that Wiccan makes love with our Lord Immortal. Not only ing block of the family, it is the very foundation of the household or co of making love, but the act of two people seeing our Lord and Lady in
From this foundation, children are born and adopted. From this fo ships are forged. It is a foundation not only in the sense that the livi couple provides a place to meet (a household) but that their kith and k order of the term household (coven). This is as it was among the prereligions on which Wicca is based and it will likely be the way Wicca future. Why? Because the natural foundation of love and union is m than covens built by Super Wicca Man.
Although handfastings are commonly entered whimsically by so

Gods and Goddesses of Matrimony
Atahensic (Also known as Ataensic)—Female—North America Iroquois goddess who presides over marriage and childbirth.
osanoessesoarm
Atahensic (Also known as Ataensic)—Female—North Am Iroquois goddess who presides over marriage and childbirt
Bhaga—Male—Near East
Hindu god and patron of marriage who is also associated prosperity.
Chalchiuhtlicue—Female—North America
Aztec goddess of all the waters of the Earth who presides
Marriage and the agreements made during those rites.
Demeter—Female—Mediterranean
122 A Wiccan Bible
nages and married women. As Demeter Thesmophoros, her role as goddess of marriage is celebrated at the Thesmophoria. In times of old, folk traveled
Demeter—Female—Mediterranean
Not only is she one of the major goddesses of Greece, she i riages and married women. As Demeter Thesmophoros, he of marriage is celebrated at the Thesmophoria. In times of o from great distances to be initiated to and participate in he
Freyr—Male—North Europe
Norse god of rain and crop fertility who is called upon to bl folk felt and feel about marriage.
Frigg—Female—Northern Europe
Norse goddess of matrimony and pregnancy, she is wife t highest of goddesses in her pantheon. This speaks volumes fo folk felt and feel about marriage.
Gekka-o—Male—Far East
Japanese god of marriage who binds the feet of lovers to o red silk, so they are forever attached.
Hera—Female—Mediterranean
Greek queen of the Olympians who was worshiped mainly matrimony who brought good fortune and favor to marriage
Hulda—Female—Central Europe/Northern Europe
Elder German goddess who presides over and blesses marr
Hymen (Also known as Hymenaeus)—Male—Mediterrane Greek god of marriages and the celebration of marriage. riage as a rite of passage.
Janus (Also known as Bifrons)—Male—Mediterranean
Roman god who is primarily cited as god of doorways and ga a god of matrimony, one sees a reference to the ancients r riage as a rite of passage.
woman through her life. On the issue of marriage these were Juno Pronuba Juno—Male/Female—Mediterranean
Sometimes cited as aspects of the goddess Juno, other time ties, the Juno are a variety of ancestral spirits which prot woman through her life. On the issue of marriage these wer (brides and brides-to-be), and Juno Iugalis (married wome the Juno of marriage itself).
Mangar-kunjer-kunja—Male—Australia
Creator god of the Aranda who presides over the institutio the promise of courtship for marriage.
Nuwa (Also known as Nugua, Nu-kua, Nu Kwa)—Female—Central Asia
Liber ab Matrimonium (Book of Marri between husband and wife.
Nuwa (Also known as Nugua, Nu-kua, Nu Kwa)—Female
Chinese goddess of the institution of marriage and the ag wuw.
Ot—Female—Central Asia
Mongolian Fire goddess who presides over and blesses mar
Pattini (Also known as Patni)—Female—Near East
One of the most praised goddesses on Sri Lanka (Ceylon), marriage as well as a goddess of rice, grain fertility, and pre that was respected as a matter of law between different people.
Svarog—Male—Central Europe/Northern Europe
Slavic god of marriage, Fire, and the sun, he is said to have c as a universally recognized rite of passage and an institut that was respected as a matter of law between different peo promises.
Var—Female—Northern Europe
Norse goddess of marriage agreements. She listens to the between married couples and brings punishment to folk w promises.
matter.
matter.
Although I do not feel the first marriage is any more or less sacred than the next, I should point out there are at least a couple of goddesses and festivals that were, in
The First Marriage
Greek goddess of the dawn who is the patron of first marriages, and Matuta, Roman
Although I do not feel the first marriage is any more or less sacred should point out there are at least a couple of goddesses and festiv times of old, reserved for women in their first marriage. Two examp Greek goddess of the dawn who is the patron of first marriages, and goddess whose festival, Matralia, was attended only by women in their believe this supports two principles: that marriage is indeed sacred an the first marriage needs just a little bit of extra help. After all, before yo can you really know how to do it?
logical that if that choice is important the decision should be given time. So let me tell
The Second the Third and the...
,,
While riding on his wife Eagle, he saw a salmon and he leaped off Eagle and dove
124 A Wiccan Bible
the story ends when he is swallowed by a whale.
Pagan lore is so clear that making the right decision about marriage is important that While riding on his wife Eagle, he saw a salmon and he leaped off towards Salmon, hurting himself as he hit the water. So he then mar the story ends when he is swallowed by a whale.
Pagan lore is so clear that making the right decision about marriage a test period is built into the Wiccan rite of marriage. Let’s face it, if Ze spent any time together before their marriage, they never would have g the first place. They would have been much happier, their pantheon much happier, and so would a great many others (Heracles being at the
Marriage is so sacred and important a rite that it needs a test per are right for each other and a way to conclude the marriage should th either they were wrong about that test or that they have grown apart The Wiccan rite of marriage is called handfasting. Unlike what is all too often a lie, the Wiccan rite of marriage is not until death do us part. Instead it is said to be for a
The Rite of Handfasting
meaning is that the couple will remain in accordance with their varar for a term no less
The Wiccan rite of marriage is called handfasting. Unlike what is a the Wiccan rite of marriage is not until death do us part. Instead it is period which is the longest of ’A year and a day or for as long as love meaning is that the couple will remain in accordance with their varar f than a year and a day but no longer than how long love shall stay. Thus, be handfasted for three years and they are still in love, they are sti devote at least a asatwwO nt daytofhemaraiada ir Chlticin origin.
Many agreementsoXhorthhnmarrihgewerbmadefo gatearanda day,bot werer the most notahlereUrhngy io thamarriageofRhiuhnrn endPwall . Rsiiaanonwas orttrntroattrairnfrdivnacr.rThrrtraoratdrthrrcntcr.trthatrarcnu.l return in e year dydadhy.AigertyaS aaerandadah. mar xanni ioyerfathnr’s aourt wlrere Pywll did win Maalrandawoy frnmS і\\;і\г І.Ноать-епох гіпг“є.у;іі. ore aftye reasons Pywll \\ oiit. l wloancl оО^Пігігєпоп fro mGwawlis, myanf|Ruetonnotyeryrar oaaaaye go Gwawl, bug wai aog aa lovy. Whya a..aoachye br Prwll, ayguaa aa a ryaa aae a ear. Afgya ghag ryaa aae a ear, ghyr wyag go h whyay Prwll eae waa hya haae awar faoo Gwawl. Howyvya, wy iyy ayaioai Prwll woa ghy haae of Rhaaaaoa faoo Gwawl ai, aa .aag, euy aae a ear.
Eaalaya, Prwll oacy gaaeye .lacyi wagh Aaawa, Loae of ghy Uaeya aae a ear. Aloan wagh .oiagaoa aae eugayi, Prwll gook oa Aaawa’i a Pywll becameArwan’sfrihn1 bviheairtris hcdhrnoiiniidtsdinnet. hakmg advantage of Arawn’s wfreduring tjuatyeaaanda0 ayfr’v-x.looiilsarlady'shan- bytye vfrtr e iloiyii of faayaei. I ao ifay rof iaa aoanaay ihai a faayaeiha. eaih Aa jfii a laiily dai -f ryanhi.
Prrll dyiaoy baraaii faayae dr ihy iaaify hy eyo-aiiaaiye aa a
The First Rite of Handfasting
Liber ab Matrimonium (Book of Marriage) sion of courtship and not during. While it saddens me to say this, many of our younger
The First Rite of Handfasting
perform the first Rite of Handfasting after a month-long courtship or after a few months
The first Rite of Handfasting is the engagement. It is what happe sion of courtship and not during. While it saddens me to say this, man folk tend to see this rite whimsically. I cannot tell you how many folk h perform the first Rite of Handfasting after a month-long courtship or af trading emails on the Internet. Only if a couple can be judged to be dedication should anyone perform such a rite. Some argue that a c allowed to court first. Of course they should be allowed to court, but before an engagement. Others argue they want a promise of monoga times that is what is on their mind, but they won’t admit it. Or maybe th sure a person is bound to them. Well then, ask for a promise of mo binding now, but don’t involve a Rite of Handfasting to establish mono because handfastings do not automatically assume such a thing unless t that into the varar. And even once they are included in the varar, Handfasting does not magickly bind two people together. Instead, i marks the magick that binds people together.
The commitment is always for a year and a day or for as long a Generally speaking, this commitment is also to live together under t which they will be legally joined at the second Rite of Handfasting. Thu a marriage itself under the Wiccan religion, but it is one that is much e the engagement, Yeesy’t uhatahavlutolyve stroythv surprireofepropysal?Nd,itdoe t not. When I say thefirneRiOe ofHanilfostingusIheengegemenr,1 meantlidiititwaat divorcestyslpw.sInstepd,spssimplesHpndpprtingswillsdo.
celebrate life by imitating Side. Pte rinpitneiSisnomoretheaqten poeposide thanis test symbolic Great Ritetneconeemmatlon ol'iPaitinion.
Should one want іортпропа to aiiotheS'lee thataettangolo his or her love.Shoe 1° in done to eptk tde engpgeeent. seeeetet, Wiccpn titipln pte npc celettate lite ty ieitating lite. Tde tite itnelt in no eote tde act ot etoe nyetolic Gteat site tde connieeation ot tdat inion.
Sdoild one gant to etoeone to anotdet, let tdat eetnon go to din ot de ot nde denite to excdange a ting at tdat tiee, tden de ndoild tting it gitd yoit vatat, yoit etoeine. Let tde eetnon knog gdat yoi ate anking Ttint ee, it in eote toeantic to extend tde eoeent on tent knee tecit yoit vatat to tde eetnon yoi love tdan to ank it de ot nde gantn to get dit otdet eetnon acceet tde vatat, tdey gtite tdeitn and ottet yoi tdeit eto getdet, tde coiele tden dincinnen tde vatat intil tdey attive at a tealin
The Second Rite of Handfasting
The second 1it6 of Handfasting is a legal marriageilfcnnBubled under barbaric marriage laws (laws which restrict consensual sexuality), then instead of the permission
The Second Rite of Handfasting
be devised. I am told that in many areas such barbarism is combated with something
The second Rite of Handfasting is a legal marriage. If conducted marriage laws (laws which restrict consensual sexuality), then instead o of those barbaric communities to be wed, a varar of equally legal bindi be devised. I am told that in many areas such barbarism is combated called a domestic partner agreement. In short, if you are a couple of d should combine the second Rite of Handfasting with the legalities of are a same-sex couple or if the marriage involves more than two peopl a barbaric community (one that will not let you be legally wed), you sh legally binding agreement similar to the binds of a legal marriage.
In an ideal world, the legal portion of this Rite might not be nece am disturbed by governments that regulate religious rites. However, i riage is to command the same respect as any other marriage in the gre it should be just as subject to government authority as any other. In f law and religion, the legally binding part of the union can be conducte rite itself or it can be performed beforehand. In my view, it should n after the second rite of hand fasting because I have seen too many pe spect for this rite by not following threw with that step. If the legal uni before the Rite of Handfasting, it can be a simple matter or grand. T encouragement in Wicca to deny family even when they refuse to
The Third Rate of I IiHblt.) . w 1I;;- u !11.1 II n Kuou ofHandparf ng
Because Wiccaefeoallthings with a beginning, a middle, and an end, the third Rite of Handfasting is either a Rite of Handparting or a deathbed promise to continue lov-
The Third Rite of Handfasting and the Rite of Handp marriage is coming to an end and that the two should part as friends, welcoming reunion if it should comeagain.
lfIHamdfastimgIisIeithefIaIRiteIlfIHamdIaftimgIlfIaIdeathbedIIflmise more than a year agde dayfremrhhseconehangfestinw, bud Ihatlovedidnot st ay.Tlie spirit of the Rite islhalehltoiiolitnie union hasparSnd,lheydo io nsfrienpaandnhouM umilm if ie isluld clTe agaim.
told that although thHovsyletriedi thdirunionisdicsfivyn.
Tefe esaa a ueaf aad a dau ffeT ese ieiead saadfaietag, bre esae leve iytfte ef ese Rtee ti esae aleseres ese ratea sai yafeed, eseu de ie ai fft future, the couple do esnot wanlthe ende.’ihein mweriegseo beiheenoo f their which . eeld esae aleseres ese ieryle efted, esetf ratea ti dtiielred.
1i Haasfaietae, esti ti a seaesbes yfeTtie, ieTeestae eaeefes ta ieeTi aeaf. Tse iytfte ef ese ftee ti esae aleseres a refu feal yafeta Why Three Handfastings?
Liber ab Matrimonium (Book of Marriage) three states in all things, a beginning, a middle, and end, as we discussed in Book of
Why Three Handfastings?
Pywll), then one proves virtue again (Pywll waiting for Rhiannon), and then one proves
There are three Rites of Handfasting in the Wiccan religion be three states in all things, a beginning, a middle, and end, as we discu Three. There are three because the first one proves virtue (the first y Pywll), then one proves virtue again (Pywll waiting for Rhiannon), and vagrrteueemaegantnis(tteestmedararnadgethoenPtyhwe mtoarRriagaeninsomn)a.dFe.rsHt oawn eavgerreemmaeknitn not a promise for this world, it is a promise for the next.
involved. If Wicca is truly built on the pre-Christian fertility religions, our celebrations
Why Public Rituals for Engagement Marriage and Pa ,,
One of the failings of many views of Wicca is that the non-Wiccan c involved. If Wicca is truly built on the pre-Christian fertility religions, should include much more than just Wiccans. Until very recently, su on the entire family pulling together for common goals. Is not the bl riage one of those common goals? Historically and today, such matt roles of religion. While you might have a knee jerk reaction to this sta religion should not be involved in such matters as social law and con providing those services then what is it doing?
One can be spiritual without being religious. So why then would w one might as weli callooe’s abligionCaackandrdwwuldmounjustmumuchN
So how can Wn:co ke aueligcopwhenitsaysAadonemmstdecido thesemattersfor oneself? It does io uyt.ho Wicccc’sestimotionofwhaithwuethmnsareand then by boioat wiliovor l yorsoa wlais ii io sola. Loi’s cljo ii; ic iio wort oao sigii ln wooo jloo oao’n yooigioa Cyljk lat ii wouot sola juni ln decide if you will havuiww mambcca to lhat moariaeeithrny, oewUaSeveunumbes .
oaonooc? Ii toon no bi iio cijjla’n oniisliioa oc wili iiono iiiagn snykiag iione sniieyn aiii yuboij yiiuno io ieoo iieiy jossuaiiy aini cijjn toen aoi tejite ic youy snyyinge aioo be soaognsoun oy aoi. tejite ic you aioo inve iao sesbeyn io iini snyyinge, iiyee, oy ai cijjn toen aoi tejite ic you snyyy n nnseenex ynyiaey oy n sesbey nex. Ia noo iiene iiiagn nat soye, you tejite. Bui iiea you oei iie yeni iini tejinioa in by youy vnyny aiiji in yent tuyiag yiiuno. So niouot y ninie iini you aioo be soaognsoun, youy jossuaiiy kaoan iini ii ao iaiyute uyoa ii. Siouot youy snyyinge be oyea, youy jossuaiiy kao iajounioa in aeojose. Ii in ia snkiag iiene iiiagn kaoaa iini youy c aiii oiiey yeoyoe’n cijjn. Ii in ia snkiag iiene iiiagn kaoaa iini jossuaiiy yeoigioa.
Lustral bath—Taste and smell aae of paime concean as smelling and licking might follow. Myatle is said to bless unions of maaaiage.
Dress—Personally, I will be married in a tux because the greater community says it is
128 A Wiccan Bible
dings are fun and they do tend to be popular in thAWiWicncnmmbmty. However, if it is a medieval wedding, please do let your guests know that Wicca is not a medieval Dress—Personally, I will be married in a tux because the greater com the finest way a man can dress, and I want only the finest for my love dings are fun and they do tend to be popular in the Wiccan communit is a medieval wedding, please do let your guests know that Wicca is religion.
Asperging—Consider using branches of Myrtle as they seem to pop u again in lore surrounding weddings.
Smudging—Experiment with incense by blending herbs and resins in the bride’s and groom’s astrological signs. There are many books tha formation. A quick reference can be found in Wicca Spellcraft for Men (N they should be asked to leave the Circle. Including a final opportunity for the bride or
Challenge/Outsiders—Here one might want to ask if anyone oppo speak now. If one does, that person can choose to stand for the weddi or she will ignore that objection after the Rite is concluded. If he or sh they should be asked to leave the Circle. Including a final opportunity groom to reconsider is also a good idea.
ters scattering the groom’s flowers. Those flowers mingling and falling to the ground Casting the Circle—Consider using petals from flowers that correspo and groom’s astrological signs. Perhaps the Circle could be cast the first maiden or maidens scattering the bride’s flowers and then by a flowe
Invitation to Lotte gosh lray-Sy rr batter beautwful to taoofote stentetationdo our Lord and Lady in the exchange of varar. After that invitation, the couple could perInviting the Four Quarters—Ah,oahltotettetojttoattotheotn-llas?
joins their hand with a red silk cloth and then takes the athame and chalice away, so Invitation to Lord and Lady—Itotsotlthetoteluttaulottotncttpttlteotheo jttheysooclneokttossloslaoealy.oloteosoctolnoenolesoeollreolno
Further information on the Rites of Handfasting can be found in Wicca for Couples.
I know I have already said at least a dozen times that this is only my view of Wicca. I
Chapter Comments
that more in this chapter than any other place. What is in my heart might not be what is
FutthetotnattrltttnotnotheoRttesotaoHlndalsttngoclnoteoatundotnoW IokntaoIohlveollteldyosltdoltolelstolodtzenottresothltothtsotsotnlyoryo kntaothltoIoteglnothtsotttkotyoslytngothltolsoaell.oButoplelse,oplelse,op

Liber ab Sol
Liber ab
A Discussion of the Sabbats
ere Уои w'" not ''nc' sPec'l'c instructions for conducting rituals for each II of the Sabbats, the eight solar Holidays. You will find no drawings to tell I I . I you where to put your feet or sequence of events. This is because there J is no set place for you to put your feet or sequence of events that you Г C must follow. SurelyTyowwishto indorecrateawultzontangcinduthn o celebration of thyreritea.yoiiwilllikely isek ayodkorinstrwctiondos doing so. Therein you will find sucWhnstruytron . Silt. ohet isnequhnerOo rvnwhich I
cs iy set rlkce oyr yyo ty rot yyor oeet yr seqoeice yo muIt oyllywr eusely co yyu wcIl ty cncysryskte k wkltz y celeysktcyn yo tleIe scteI, yyu wcll lckely Ieek k yyyk y dycne Iyr clesecn yyu wcll ocnd Iucl cnItsuctcyn, yut tlkt cI nyt tle kddseII tleIe celeysktcynIr I km nyt k dknce cnItsuctysr
InItekd, lese yyu wcll ocnd tle lekst yo wlkt I ocnd cmrystknt ky Wccckn aylcdkyI, tle lekst yelcnd tle sctuklIr cyrccklly, tley kse tle k tlkt kse cynducted yetween tle yrencne knd clyIcne yo Wccckn sctukl lcesr ayweves, tlese need nyt ye tle oysmkl yrencne ys clyIcne yo k sct ye Ikcsedr Cestkcnly ct cI myse cmrystknt tlkt tle scte ye exrescenced t

You will notice I have not spelled out specific rituals for each of these Holidays.
130 A Wiccan Bible
format is one of the things noted by the word Wicca. WthoughBtuals vary from group to group, the theme remains the same. That which we find in the middle, the celebra-
You will notice I have not spelled out specific rituals for each of Generally speaking, Wiccan rituals open and close as discussed in Sect format is one of the things noted by the word Wicca. Although rituals to group, the theme remains the same. That which we find in the mid tions themselves, will vary greatly from person to person and group to the central theme is the same, the marking of the Wheel of the Year, th be interpreted by the individual heart and how that heart interacts wit the rite.
Known variously as the Sabbats, High Days, and Holy Days, these are the eight days of the year that are defined by the sun’s travel. They are the four days defined by
The Eight Solar Holidays
events. Although calling these Sabbats is most common within the Wiccan community, Known variously as the Sabbats, High Days, and Holy Days, the days of the year that are defined by the sun’s travel. They are the four the two equinoxes and the two solstices as well as the four days that fa events. Although calling these Sabbats is most common within the Wic the word that would better express meaning to non-Wiccans is holida sider the purpose of words is communication, we see that if our inten cate what we mean when we talk about these days, we could use the refer to them. Using the word Sabbat just seems to further the rift bet other mainstream religions. Of course, if your intention is more in th
to yet another groupky aolkwhowerephrrocutad fortheir religious behefb. I among course, speaking amoutihe Jewismfaith. hem inrereiting to note how many people with
T\rthplrpkhowh,pthr\rpisplloostphothihgpofpthrpp\r-Ch\istilhpfr\ thrpJo\lpllllltipItpJlspmostltplikrltpihvrhtrlpfo\pthrpfr\fosrpofpcoh toptrtplhothr\pg\orfpofpfolkpJhopJr\rpfr\srcrtrlpfo\pthri\p\rligiorsp cor\sr,psfrlkihgpllortpthrpJrJishpflithipItpispihtr\rstihgptophotrphoJpm listihctltpJrJishpsorhlihgphlmrspJr\rpfrtptoplrlthpohpthrpchl\grpof l\orhlpGr\mlhtipThispclrsrspmrptopJohlr\pifpthrplt\ocitirspcommitt mlhtplglihstpthrpJrJspJr\rphotplpcohtihrltiohpofpthrplsslrltpohpf\r-Ch Thrprl\lirstprsrpofpthrpJo\lpthltpIphlvrpliscovr\rlpispihpthrpmrlirvl lhlpJitchphrhtr\siplo,pmrchplikrpJrl\ihgplllplllck,pthr\rpispf\ollllt Joolpthlhp\rligiohplssociltrlpJithpthrpJo\li
lomrtimrspthrpllllltsplrtJrrhpsoll\prvrhtspl\rpclllrlpthrpG\rl thrpohrspml\krlpltpthrpsoll\prvrhtspl\rpclllrlpLrssr\pllllltsipThispisp f\ompJhrhpfolkpstillpclrhgptopthrplirpthltpWicclpisplhplhcirhtpCrlticpfr\til srr,pthrpCrltsplilpihlrrlpcrlrl\ltrpthrplltsplrtJrrhpthrpsoll\prvrht rhtilpthrtpJr\rpihvllrlpltpNo\srpt\ilrsplhlpothr\spthltpthrpsoll\plltsp crlrl\ltiohipIpchoosrptopigho\rpthrsrplistihctiohsplrclrsrpIplccrftpthrpf lpfost-molr\hp\rligiohpthltpl\lJspohpthrplhcirhtpf\lcticrsplhlplrli tr\rsipTop\rlliltpcohsilr\plpCrlticpHolilltplspG\rltr\ptopthrpLrssr\pG
Quarter Days:
Liber ab Sol (Book of Sun)
Spring Equinox: the day and night are equal length. The Sun is waxing.
Quarter Days:
Winter Solstice: the shortest day of the year. The Sun is Dark/New.
Spring Equinox: the day and night are equal length. The Sun is waxin Summer Solstice: the longest day of the year. The Sun is full.
Fall Equinox: the day and night are equal length. The Sun is waning.
Bealtaine: the day that falls between Spring Equinox and Summer Solstice.
Cross Quarter Days:
Imbolg: the day that falls between Winter Solstice and Spring Equino Bealtaine: the day that falls between Spring Equinox and Summer So Lughnasadh: the day that falls between Summer Solstice and Fall Eq Samhain: the day that falls between Fall Equinox and Winter Solstice
Note: In naming the Cross Quarter days, I have used the Celtic na preference or dominance, but to ease understanding and reference. tion of spelling variations, these are the names most often cited.
with each year. Your best source for the specific dates marked by the sun is your local Collectively, these eight days form the Wheel of the Year, the so
only gen |
erally accepted dates that are c |
ited in many books. The actual |
with eac |
h year. Your best source for t |
he specific dates marked by th |
newspap |
er. For the Cross Quarter day |
s, just do the math. |
Win |
ter Solstice Solar Qu |
arter Decemb |
Imb |
olg Solar Cro |
ss Quarter Februar |
Spr |
ng Equinox Solar Qu |
arter March 2 |
Bea |
ltaine Solar Cro |
ss Quarter April 30 |
Sum |
mer Solstice Solar Qu |
arter June 21 |
Now to make things just a little bit more confusing, everything that has been said
132 A Wiccan Bible
different story:
Nce |
lc ooke leinet jutl o lillle a |
il occe tcnoutine, eveceleine |
oacve le |
it tenlente it occ lee Ncclee |
cn Heoitpeece. Scule co le |
Fall Equinox |
tlcce: |
March 21 or 22 |
Su |
oec Scltlite Scloc Qu |
oclec Deteo |
Lue |
enotooe Scloc tcc |
tt Quoclec Feacuo |
Fol |
l Equincx Scloc Qu |
oclec Mocte |
Soo |
eoin Scloc tcc |
tt Quoclec Apcil 3 |
Wi |
lec Scltlite Scloc Qu |
oclec June i |
Spring Equinox Solar Quarter Septembe
Bealtaine Solar Cross Quarter April 30 o
not take this to mean that Wiccans south of the equator do not make an effort to celebrate the Sabbats in accordance with this concept. However, consider the south of
Because Wicca was born/reborn in the Northern Hemisphere and ences of larger religions, these Holidays are not typically respected in t not take this to mean that Wiccans south of the equator do not m celebrate the Sabbats in accordance with this concept. However, consi the equator Wiccan who celebrates Yule at Summer Solstice when the
This state is sad,asitis a murther dieleactiongromthe conccunof Wordasc Lady. The Christian religionwithiie concept ofgod beingaetoiilyinthe maoci^i5inedoeonot hhe serse of i liogeo ,ommurdhe ds li,kdrg ih Summeo Solshd,e. The into their Holidahu. Those majcuhne aedfcmmino drmciplea arcaddor voimfoimda-tion of the Wiccan relieioniandtliooboiltlntooiioHoiiclayo.ThcconfiisionoiOycomoo in with the idea ofstatie daior. It aea creinrhoNnrthero HcmispCerewcseethetrOe illcw occ lhe ailinte co oittuldne ino oeodndne pcdntdplet, tc co tcu
licn co lee Wit |
ton celieicn, ono leut auill inlc |
cuc Hcliooet. lee tcnou |
in eile lee ioe |
o co tlolit oolet. Io ee oce in le |
e Nccleecn Heoitpeece |
Hcliooet oce: |
Summer Solstice (feminine) |
December 21 or 22 |
Holiday |
Counterpart |
Appro |
Sooeoin (o |
ottuline) Beolloine (oe |
oinine) Otlca |
Winlec Scltl |
ite (oottuline) Suooec Scl |
tlite (oeoinine) Deteo |
Ioacle (oot |
tuline) Lueenotooe |
(oeoinine) Feacu |
*Spcine Equ |
incx (o & o) Foll Equincx |
(o & o) Mocte |
Beolloine (oe |
oinine) Sooeoin (o |
ottuline) Apcil |
However, in the Southern Hemisphere we see that the Holidays are:
Holiday |
Liber ab Sol (B |
ook of Sun) |
Samhain (masculine) |
Bealtaine (feminine) |
April 30 or May 1 |
, |
c the Ssitheic Hemiipheie w |
e iee thst the HsIidsyi June 2f or 22 |
Holiday |
Counterpart |
Appro |
Ssmhsic (m |
siiiIice) BesItsice (fe |
micice) ApiiI |
Wictei SsIit |
iie (msiiiIice) Simmei SsI |
itiie (femicice) Jice 2 |
ImosIg (msi |
iiIice) Lighcsisdh |
(femicice) JiIy 31 |
*Spiicg Eqi |
icsx (m & f) FsII Eqiicsx |
(f & m) Septe |
BesItsice (fe |
micice) Ssmhsic (m |
siiiIice) ApiiI |
Lughnasadh (feminine) Imbolg (masculine) Febru
culine in transition into feminine. Fall Equinox is feminine in transition into masculine.
One can easily argue that the names of these Holidays are important, and that * Note that the equinoxes are both masculine and feminine. The Spring culine in transition into feminine. Fall Equinox is feminine in transitio associations made by our connection to the natural rhythms that are important. Re-
One can easily argue that the names of these Holidays are imp being of Celtic origin, we should preserve the dates that have been tra ated with them. But that argument pales when we accept the simple requires both advancetndretreaS.bmoumeccoupoc waltumg;one pursonletds tardance, and the otmerbsleadin snmmhtio'.Inthis thaiCpIti tnsimportsntissueisthat impoitact is cot thi cami, Iit thi iilatiocship iipiisictid.
Oii Iscgisge ii iiih thst it ii diffiiiIt ts expieii the ides sf the i ieqiiiei osth sdvscie scd ietiest. Imsgice s isipIe wsItzicg; sce dscie, scd the sthei ii Iesd ic iymmetiy. Ic thii exsmpIe, the impsi the isipIe ii dsciicg, cst whs ii Iesdicg the dscie. It ii the ieIstisci HsIidsyi scd theii mstei thst sie impsitsct. It ii sIis cst impsitsct t
Longest Night of the Year
Fourth Cross Quarter^
{Masculine
First Cross Quarter
Longest Nigh
Winter
\Dark Half of the year
Four
Summer
Third Cross Quarter Ligh
Longest Day of the Year
ss Quarte
Mecond n'ross Duarter
The Eight Spokes of the Solar Year (reprinted from page 50)
he Eight Spokes

Fcmrnqr nolstice
Lughncocdh
The Wheel of the Year
When considering the traditional date of a Holiday it is important to remember that in ancient times the day began and ended at sundown; thus the light of each day is
Darkness Before Light
Diana (Darkness) and Lucifer (Light). Prior to their separation into two beings, that
When considering the traditional date of a Holiday it is importa that in ancient times the day began and ended at sundown; thus the lig preceded by the darkness of that same day. This principle is represente counting each by degree around the Wheel of the Year. This method counts Winter
Liber ab Sol (Book of Sun)
stressing of the importance that the Germanic tribesassociateolwitlithe unlstice. To a much lesser degree, some choose to begin with Fall Equinox, commenting that the Fall
counting each by degree around the Wheel of the Year. This metho Solstice first, or at 0 degrees on the Wheel. These opinions no dou stressing of the importance that the Germanic tribes associated with t much lesser degree, some choose to begin with Fall Equinox, commen Equinox marks the division between Summer and Winter, so that da the end of the old year as well as the beginning of the new. Those folk Fall Equinox as at 0 degrees, Samhain at 45 degrees, and Winter Solsti
In considering these two ideas of where to start the new year, I fi middle. Yes, the new solar year is marked at the Winter Solstice, but t which our Lord Winter is at his strongest. Certainly we are not at eith at the moment of our birth. Instead, I find Winter Solstice to align attribute of maturity, his Father stage. Keeping in tune with the threef culinity (Master, Father, Sage) this means that He would have bee Master stage during Samhain and at the Holiday prior (Fall Equinox) let the Homed One rule
be newborn/infant. Consider the following from the Wiccan Rede:
When the Wheel has turned to Yule
legt the He oorgn,ed One rule
marks the end of Summer, but because it is the first Holiday of Winter, said to be the
—From the Wiccan Rede, Author seems like the natural way to do things.
In our larger woridcultmry, thecalecdan clay idconsidesed the24hoursaetween midnight and mmaight.InsomhEestmrr aud Nrtiae American cutturrsdshrc Went considered sunricetosonrire. Fmalla, inmanyWesternnnlSureslt bhio eunceenacthn amount of time beAween sunieAandsunsat , Hdre again we see the principle of Dark-
Io hei ,aicni shi,d te,tein, tIn ta,nodai day it thotidnind tIn 2 midoicat aod midoicats Io nhmn Eantnio aod Nativn emniitao te,t were far more rc^^ilold-prdtttiitlieineasiior ofGetmanicaustams.Ataoennmiile, amheot hc timn untsnno neonnt aod neonnts unin acaio sn nnn tan pi antt thmiac unchin Licats
Makiac mattnit nvna mhin thacetiac, tan attea, datnt hc tan sh,ai snin cai mhin c,nxiu,n piihi th tan iavatiha hc Gnimaait tetthmts
Bna,taian ahppnd aihead th meta taat thmn ch,k titn it at uniac a m nitani piihi th hi actni itt teiinat phtitiha ha tan aann, hc tan Ynai tan idna taat tantn taiact ain maiknd ut tan Eaita’t tiavn, aihead ta thmn meta natini th p,atns
sh, sana it tan untt attea, datn th tn,nuiatn tantn nvnatt? an,,,
Seasons of the Sun
The final consideration before discussing the AolidaysaneBsdees is to state that the Holidays are not simply days. Yes, those days are often marked on a calendar, but
Seasons of the Sun
days on a more or less specific date, but that date should be thought of as the culmina-
The final consideration before discussing the Holidays themselve the Holidays are not simply days. Yes, those days are often marked o those days are simply the peak of the season by the same name. We ce days on a more or less specific date, but that date should be thought o tion of the season. Samhain, for example, is most often celebrated o however, the season of Samhain runs from Fall Equinox through Sa we typically see Winter Solstice marked and celebrated on or around however, the season of Winter Solstice runs from Samhain (the end season) through Winter Solstice, the day on which the season is marke has not been the typical Wiccan view, it does seem rather naive to thi or planting would last only a single day.
While this might sound a bit confusing at first, this way of viewing

Seasons of the Sun
Seasons of the Sun
nmg, middle, and an end, as do all things. With this explanation, we see that at Samhain we can be truthful in saying that we are celebrating the peak of Fall. After all, as a nature based religion that is exactly what we are celebrating, even if a small portion of
Here we begin to see four seasons instead of just two, each season
Season |
Beginning |
Middle |
End |
Fall |
Fall Equinox |
Liber ab Sol |
(Book of Sun) |
Winter |
Winter Solstice |
Imbolg |
Spring Equinox |
Spring |
Season Beg |
inning |
Middle End |
Summer |
Fall Fall |
Equinox |
Samhain Win |
er 3

The Four Seasons
General Recipes
If possible, it is best to use recipes intended for specific Holidays. If that is too much work for the occasion, a general use recipe is the next best bet.
General Recipes
If possible, it is best to use recipes intended for specific H too much work for the occasion, a general use recipe is the
Winter Holiday Oil
1/2 ounce base oil
4 drops Nutmeg
4 drops Frankincense
10 drops Pine
1/2 ounce base oil
Summer Holiday Oil
1/2 ounce base oil
4 drops Patchouli
4 drops Otto of Rose or Rose Geranium
10 drops Pine
1/2 ounce base oil
Winter Holiday Incense
4 parts Sandalwood
4 parts Frankincense
2 part Myrrh
2 part Benzoin
· 1 part Clove
· 2 parts Lavender
Samhain
Winter is at the youth/Master stage. Summer is entering the first trimester.
Shi Samhain
Martinmas, Samonios, Samhuinn, Santos, Third Harvest, Winter’s Eve.
Date: Approximately October 31st, this Holiday is actually found on the day that rests
Liber ab Sol (Book of Sun)
God association: Oengus Mac Oc.
Goddess association: Bhavani, Carlin, Cerridwen, Hecate, Moingfhion, Nicneven.
Gemstone assoclDtaonSA Obsoxif Onpq, and CameShrn.
Plant associationGOdlbpi“iAppn:oCagiUp,Chcysanthemum Corn, Gourd Grains (all), Hazel, Pears, Pomegranates, Sage, Squash (especially pumpkin), Thistle, Wormwood.
Goddeii aiiociation: Bhavani, Carlin, Cerridwen, Heca.e, Coingfhio
Plant aiiociationi: Allspice, Apples, Ca.nip, Chrysan.hemum, Corn, Go Hazel, Pears, Pomegrana.es, Sage, Squash (especially pumpkin), This.l Color aiiociationi: Black, Orange.
Samhain Incenie
1 par. Allspice
1 par. Sage
1 par. Frankincense
1 par. Gum Arabic
Samhain Oil
1/2 ounce base oil
8 drops Allspice
6 drops Sage
6 drops Frankincense
dividing the year intoSuaemerend Winter would be drawn from Samhain to Bealtaine. That is just as valid a way of looking at the Wheel of the Year as any. However, when we consider the names ol'the twohal—soinhe ye ar,weaeeareasonnotPoapiiithe year that way. Winter, cnllk dtheDork half eSSl eyear,impliea tharit weuldboet raelS of the year in whichthere ia tie ieart asnnnnt eUlightoasm.Th aihairoU l:lre nerr is better marked at tOeFshan ilSpring E^uinna becauselhe iensthaC nayslstheshostest ra aruyciae eoa uenay rl eoa err oecvay rl eoa ,aee, ra yaa e eaeyru ,lee esee re,. hcuele, aeccli esl Deek seca na esl ,lee, cnpccly esee ce r na esl ,lee cu rscas eslel cy esl cleye ennSue na ccase ne ySu. tsee s aleele neekli ee esl Fecc eui apecua EqScunx alaeSyl esl cluaes na ie nu nul ycil na esee ccul eui cnualye nu esl nesle ycil na esl ccul, esSy icpcycnu na esl ieeklye seca na esl ,lee eui esl ccaselye seca na esl ,le ylpeeeel hcuele (esl Deek seca na esl ,lee) eui aSnnle (esl Lcase se esl EqScunxly, nekcua aensecu esl aceye Hnccie, na esl ,lee eeesle es nleuy esee rsccl aensecu aeu nnye ilacucelc, al anuycileli hlr tl
the ancients viewedthirtimeo. tfe^ar.KnownveriouslcaslheBloudFkcuS nrlllwY tlee’y Epl rnSci al anuulaeli en esl anenle ,lee.
de cy e ecnl na elaclaecnu nu esl eeye tlee eui e ecnl en eceu es eyynaceecnu alerllu aensecu eui aelys nlee annly aenn escy elaclaecn esl euacluey pclrli escy ecnl na esl tlee. Kunru peecnSyct ey esl Bcnn
This Holiday speaks to us of insuring that last year’s matters are complete and are
140 A Wiccan Bible
extra stores (money) to pay the utility bills that nse as Slsetemjrerature lowers. Generally speaking, my store does not accept new business contacts or expand our merchan-
This Holiday speaks to us of insuring that last year’s matters are c put to rest. It’s when you make sure the storm windows are all close extra stores (money) to pay the utility bills that rise as the temperatur ally speaking, my store does not accept new business contacts or expa dise offering during this time of the year, going instead with the tried covens do not take on initiates during this time, for the same reason.
But this is so much more the case after Samhain. If we have not do you before, we will not start a relationship during this time of the yea that you contact us again after Bealtaine. Why? Because the Pooka w all attempts to harvest between Samhain and Bealtaine. While it may superstitious, ancient lore warns that the Pooka will curse all crops no night of Samhain. While I do not believe some dark force roams the c ing for that last pumpkin to curse, the story of the Pooka does well t this is a time for new beginnings and as such, we are best to move on.
In its aspect as being the day on which the veil between worlds a can compare this day to Mardi Gras. No, it is not so much the day tha last and the new year, but it is the last day of that transition. This is m Tuesday is not the whole of Mardi Gras, but it is the last and most Which brings us to our ancestors and why they are celebrated on this
Like no other Holiday, Samhain speaks to us about death, thus re that we will be whb them agaiii.and Syrnowwecsicbret.et.hedoys\\ulteve left.
Couples—Wtreecoupue yddrescprs the grief of loss togemret, theme is u ^aOtoolk spirits. Ayd what do we tell thee whey they arrive? That while we eis ship between the two wstrengthened.thm bnngmgbenehttoewte mentbere.ht .srocne-times easier for a person to share grief and honestly address the issue with someone to
Couples—Wrey b lettle bssteccec ere stiem em lecc eeseerett ere beys ebse. Yect ere eeebet extetieyliys stiem ic eece leemeteest crit beeeeey ere eee ic ceteysereyest ertc btiysiys beyemie ee beer ee at what they wrote lec.yeasand aitcucen othruceestesandfriouscs.tiisakc ati mcto eree erbe tetcey ic iyeiebee.
Iy keetiys eier ere ereee em temleleieyt eric ic by exlelleye eiee per for use in anoutsiUee offirino-TOiscanOedone simply bypiacingiOem intoe burning fireplace.
tGetieevlbyelyecebbysettcteblbeec lbyy beebsiecltccyese ceeeeleseebyse erceyb eeteieceeeyv tet met tce iy by eteciset emmetiys. Tric lby be seye cietlo bo tlbl showing those in our line that we enjoy and appreciate the gift of life that they be-ttyys tetble.
Coven/Household—Wrete ceee eetls lelebtbee eric Helisbo c forth to the nighrthenbmetofttю sewlioheveeomr Ь^ок.^0eciallythisr motheet and fathers should they have passed. The prayer found in the introduction to this book
Liber ab Sol (Book of Sun)
as she reads the prayer. Yes, it was done in e mere e,b utos youwihseewhnn we come to our discussion about Winter Solstice, just because someone else does, it does not and fathers should they have passed. The prayer found in the introduc is most appropriate. If you want to be dramatic, the host can hold the h as she reads the prayer. Yes, it was done in a movie, but as you will se to our discussion about Winter Solstice, just because someone else d mean that you cannot.
The host and hostess are then charged with inviting others to ca ones. If you have guests who are not members of your household, use members to guide them in these invitations. They can be loud, soft, sp ken, but the spoken ones will cause others to come out of their shell an of loss. If host and hostess have achieved the right frame of mind ahe invitation will be sincere, and tears may flow. Those tears will lubricate coven/household members and guests.
While the calls are going on, the host and hostess then invite folk t departed loved ones, to show those who have joined us from other r we do miss them, we celebrate the life that they have given us. The dan theme. For the young and healthy, a slow drumbeat working into a with it revelations from beyond. If this is the nature of your celebra everyone knows that they should identify their own limits and make al limits of others. There is no shame in retiring to the outside of the circ tion sets in. If the crowd is older or if you have chosen a more forma
WrnWer Solztice
Winter is at the mature/Master stage. Summer is entering the second trimester.
Wi Sli
Winter Solstice
Date: Approximately Decembar 2tsm or20nd, thir Holidayimmctually found onthe longest day of the year.
God associationsACornunnos, I Icrna.Odiii.P,111.
ri yun, yarurnaa, Yui.
rDsteI Adpproxfim2ariry 1icimbir 21tr or 22.d, r2it Horiday it acruar Plants associations:A^plecBay,Ce Cti.^unnanton.Clovoditapor.Frankincense, Holly, Ivy, Juniper, Lemon, Mace, Mistletoe, Myrrh, Nutmeg, Orange, Sage, Pine, Rosemary. Color associationGoGoCLGrecn, ReC, WhlleoYellCw.
Winter Solstice Incense
Ivy, Junipir, Limon, Maci, Mitrriroi, Myrr2, Nurmil, Oranli, yali, 1 Part Juniper Berey
1 Part Cedar
Winter Solstice Oil
142 A Wiccan Bible
4 drops Clove
Winter Solstice Oil
10 drops Pine
1/2 ounce base oil
4 drops Clove
2 drops Cinnamon
2 drops Juniper
1/2 ounce base oil
that I consider the sun to be created of the masculine, but created by the feminine. This
Solitary/General—If you have never read another book on Wicca this paragraph. If you have read other books on Wicca, this paragraph tant in understanding my take on this Holiday. From my creation story that I consider the sun to be created of the masculine, but created by th is important because although I do not personify the sun, I most certai (not sex), that gender being feminine. Now if we were to personify th ated of masculine energy we would state that He is male. Note the use and not the word masculine.
Winter Solstice is one of the strongest reasons for associating t feminine half of divinity. We don’t have to look beyond the Wiccan our Lord rules this Holiday, so why then would our Lord be associated the Sun is riding at its lowest point (the shortest day of the year). The a Sun is associated with the feminine half of divinity, so when it is at its lo his arms. What man csnarguegheth e if noUathiss tsoiigett wheo hisl oveisseturoee to peak of our Lord’s influence.
Wsile ell eigse \ium niinles eie eie\ieioeelly sel\ eo gieee oui ieeuies, I fie\ esose seme \ium niinles eie sel\ eo welnome ese ieeuie sis eims. Wsee mee nee eigue esee se is eoe ee sis seioegese wsee sis lo No wonder one ofthem? s^opeaareongtoethe eadiotMs timeo clheyeaoisol Mott 24es) ee\ is followe\ by ese Dey of Csil\iee (Den. 25es). If eoe ie Loi\, just sow woul\ oui Le\y benome Motsei?
Wits tsis view we see tset Wietei Solstine is e Holi\ey of ieueio No woe\ei oee of tse most populei soegs oe tse ie\io tsis time of ts some foi Csiistmes.” It ses ensieve\ suns populeiity beneuse tse ol\ the suicide rate skyrockeis.vdde nterimpmceres es,ahddrunkdriveesare an the rs worse. ouiselves of wset is impoiteet ie life, oui kits ee\ kie.
Even esours mose of us no lonrei leve deienels fiom ese seivese o dess, lefe ses benome seidei senne Semseen. semembei esee eses es e ese suenede ieee sksionkees, veolene nieme ennieeses, end diunk dieveis e Youi sousesold merse esnepe esese esenrs, bue does ee esnepe neben fe mosels endoois end en nlose noneene vees membeis of oui sousesold n menoi ennosennes eneo seemenrls seieous essues. Fieends veesoue e ple
Couples—While it might seem difficult to separate couple from children on this
Liber ab Sol (Book of Sun)
couple than the children. Sure, chances are theearaonlopretendinotoun^leep, but still there they are in the other room providing quiet time for Mom and Dad. Is there a
Couples—While it might seem difficult to separate couple from Holiday, few can argue that in popular culture December 24th belo couple than the children. Sure, chances are they are only pretending t still there they are in the other room providing quiet time for Mom an better time for celebrating the joy of one’s relationship? Even without there is the celebration of the joy of other pleasures that have come fr union. Taking time for just the two of you is most appropriate. Per dinner or maybe something as simple as stealing some of Santa’s coo them under the mistletoe.
Take turns writing in your couple’s Book of Shadows what has com tionship that you are thankful for. Exchange personal gifts. If it has be manner. What do you mean? I asked. She told me that she wanted to celebrate Yule ar year, gs o massage are mos approprae.
Coven/Household—I had a conversation with a friend who felt t were left out of the fun of Christmas because she was raising them in a t manner. “What do you mean?” I asked. She told me that she wanted t on the right day, but her children are surrounded by the cultural celebr ber 25th. I was shocked. Has Wicca really come so far in our rebellio reject traditional Pagan ways just because Christianity has capitalized
Few disagree that the Pagan Yule was not a specific day; it was a r as evidenced by the popular Christmas carol “The Twelve Days of
Counting 12 dhouforwere, thssmie.ds thelastdayowYuneon apputnimaldvlaiuiaey 1st. An alternative way 0П00kingae thhHoliday.ttme latndii mto pseularcuhexe snd count backward frornJoFoarylslito findohYfirstdahonDscemberftth.Ehhutway will only find a varieaaaopadat oe so. Nowlhsntweat does this say of the 25th? It says
Coulealyo12outntofoadtau,oehatonaelutoeheoltteoutnoofoYuleoolotppaox 1te.oAaotleeaateaveodtnoofolooeaayoteoeheoHolautnoatoeooaleauoaeoaaeoopop aouaeoataedtauofaomoJtautano1teoeoofaauoeheofaateoutnooaoDeaemaeao dallooalnofaauotovtaataaeoofotoutnooaoto.oNodoehea,odhteouoetoehatottnoofo ehteoeheo25ehoftlltotlmoteopeafeaelnoteoeheoaeaeeaoofoeheo12-utnotettoa ateheaoampoaetaeodheaototeuunoofoeheoaeleaateaoaoofoYuleofaautoehteoeh atlleuoMoehea’toNayhe.oTheoutnotfeeaodttoeheoPtytaoaeleaateaoaoofo Chaluaea.oWheaodeoeteeoaaeooaoataueateaoaoeheotaaaeaeodtnoofolooeaa ttotetaeaayoteotuauoda,odeoteeoehteotoeatuaeaoatloPtytaoaeleaateaoaoo ueeuoftllooaoDeaemaeao25eh.oBueodhnoteopoeheae?oFaomoaoehotomou taaaeaeoeatuaeaoatlovaedpoaae,oehatoHolautnoataoaeoteeaottoaeyaaaaayote tauoeauaayooaoJtautano1te,otoodhnoaoeomteeouteoofoetahoofoehoteoutnt
Winter is at the senior/Sage stage. Summer is entering the third trimester.
Ibl Imbolg
Date: Approximately February 2nd, this Holiday is actually found on the day that rests
144 A Wiccan Bible
Goddess associations: Bngid.
Gemstone associations: Amethyst, Turquoise.
Plant association, hetmarnox, f Sil, Dragon'i Biood, FraHkinqenne, Red Sanoalwxn Snow Drop, Rosemary, Rowan and the wildflowers that have already started to flower. Goddess associations: Brigid.
Gemstone associations: Ameihyei, Tlrqloiee.
Plant associations: Cinnamon, Dill, Dragon’e Blood, rrankincenee, R 6 parts Frankincense
Colors associations: Pink, Whiie, Yellow.
Imbolg Incense
6 parie rrankincenee
4 parie Dragon’e Blood
2 pari Red Sandalwood
1 pari Cinnamon
Imbolg Oil
8 drope rrankincenee
6 drope Roeemary
2 drope Cinnamon
rary culture is. When German settlers arrived in Pennsylvania in the 1700s, they brought with them s Holiday iheycalledGandlemas.The Holiday itsaUl hasleepPagan roots a but the name CandiemaacemeGfrnmthe Chriyti ansetvich inwhicha pasestOleisea in h Wiiihn bible, ia ie yea hn.aheo H.liohy ahha illleaohaee jlea h.w P ohoy ineinot ie. nhtn Gtomhn etiietoe hooivto in Ptnneyevhnih in iht 170 At the time, the-woseosuns doyahayady gr ecrepeaced by four.soiyepointb etween Winter Sobslkeand SmamgEqainoewasteenasflic mihfleof thaWmten.Gert man lore stated thal ifthedrh aomgawithateood waathnr,she secondhnflne Welter (Candlemas till Spring Equiaox)wousalbe land. There the tradition would have re-Ai ita ilsa, ita its eahesne tho hlsahoy laan saelhiao ly esns, time, the DelawarelndiannesSablithrg a compsite aboulOaihwae betoe an tCeAHagf-shn lssa eihiao ithi le ita ohy lslnTe tlit li Tsso tahitas, ita eaisn (ihnolashe alll SeslnT aqnlnsa) tsnlo la klno. ytasa ata asholalsn
at the crossroad nCrna-e Slandsohte 0t9i
alsa,iataihalhthsaiInolhneiaeahllletaoihiihseelaaihlsnaithleithyilaat tnyihnoiSneqntthnnhislvtse.iythaiihseelatitsnloilhatsiltiihlltoionna eylvhnlh,iteahlllettoilni1723.iysohy,iattiastnileiesnnoi92isllteinssatt haiattiisseesshoiseissnati36ihnoissnati119.
ytsetiNhalvtiAstslihneiltlltvtoitnshnlayitvslvtoiesssihnlshle.
“Last Tuesday, the 2nd, was Candlemas day, the day on which, according to
Liber ab Sol (Book of Sun)
his shadow he pops back for another six weeks nap, but if the day be cloudy he remains out, as the weather is to be moderate. ”
“Last Tuesday, the 2nd, was Candlemas day, the day on which, acc the Germans, the Groundhog peeps out of his winter quarters and i
remains out as the weather is to be moderate.”
adopted by Christianity, brought to the United States, mingled with Pagan traditions,
—From the diary of James Morris’ (shopkeeper from Morgan ideal choice for inclusion in our post-modern religion. After all, the Wiccan commu-So what is commonly called Groundhog’s Day was a traditional Pag adopted by Christianity, brought to the United States, mingled with P and then introduced to a modern culture as folklore. It does seem lik ideal choice for inclusion in our post-modern religion. After all, the nity has embraced the term Candlemas to refer to this Holiday, and th more of the Catholic Church than is Groundhog’s day.
Although this Holiday falls in the Dark half of the year, its name c Lady rather than our Lord. Imbolg literally means ’in belly.’ In essence Summer has entered the third trimester. Although not yet born, this is parents and doctors can relax, knowing the as yet unborn child has where many developmental concerns are no longer issues. So pronou in development that even the strongest proponent of the pro-life mov at the idea of abortion in this stage of development. Indeed, this is th child has a chance of living outside of his or her mother’s womb.
seeds to crack their outer hheUgandsproutohave Wheunexiting Yherrshsh, riawiybat consistently.
wohrenrreetrrjt,setrr,nnedxterrrtoherseoyi.lr.rohteorc,hgenrtginegyrrteerersneorteret,rrvessrened,rrt eelrtsinggnrssrn seedsrtorcreckrtheirro,terrshellrendrssro,tsrheverbeg,nrexitingrtheirr their relationship grow with the season, then harvest the fresh seeds for the next, sym-consseny.
Couples—ohisrisrenrexcellentrtimertorslentrseedsrindoorsrforrleter tgheerirerrne.lretioonnesrhnisr rgrrcowerrowrirthnrrttheerrsetecsoennr,trherecnor,hserevretstertthrserefnretssrhsreseeesdrtsorf bolicellyrreslentingrtherseedsrofrthererlovereechryeerrendrhervestingr there is always the chance that the sun will be out and with a little bit of work, a group overonreerroeys.
Coven/Household—Inrmostrsertsrofrtherworld,ritrdoesn’trreellyrmett hogrseesrhisrshedowrorrnot.rEitherrweyritrisrstillrentirelyrtoorcoldrforro,t thererisrelweysrtherchencerthetrthers,nrwillrbero,trendrwithrerlittlerbitr cenrsteyrwerm.rWhyrnotrhonorrtheroldrweysrbro,ghtrfromrGermenyren ho,seholdrcelebretionrinrtworserts,ronerindoorrendrtherotherro,tdoo
Spring Equinox
Winter is at tlwdeath stage and begins the cycle of rebirth Bummer is at the birth stage and ends the cycle of rebirth.
Spring Equinox
Winter is at the death stage and begins the cycle of rebirth. Summ stage and ends the cycle of rebirth.
on the day when the length of night and day is equal.
Also known as: Alban Eilir, Bacchanalia, Bealtaine, Beltane, Children ter, Eostres Day, Lady Day, Ostara, Waxing Equinox oDnatteh:eAdpaprwoxhiemnattheelyleMnatrhchof21nsit hotr a2n2dndd,athiiss eHoulaidl ay is actually fou Goddess association: Aurora Black Annis Eos Eostre Ostara
Ins, Jasmine, Narcissus, Nutmeg, Olive, Orange, Peony, Rose, Sandalwood, Violet, Gemstone associations: Aquamarine, Moonstone, Rose Quartz Animal associations: Chicken, Duck, Bee
Plant associations: Daffodil, Dragons Blood, Benzoin, Ginger, Fran Iris, Jasmine, Narcissus, Nutmeg, Olive, Orange, Peony, Rose, San Woodruff, and all flowers that have already started to bloom.
Color associations: Blue, Pink, Red, *Yellow or White & Black (toge * Yellow or White to represent the day with equal amounts of Black night. Each is appropriate only with an equal amount of the other.
1 parts Dragons blood
Spring Equinox Incense
4 parts Frankincense
2 part Orange peeP
Spring Equinox OH
8 drops Frankincense
6 drops Nutmeg
Spring Equinox Oil
Solitary/Gen8ral—SprisnFquinox is a fertility celebration of the second order of life. From culture t.ocnS.iirUtBx;ilt;iiiie moves either direction on the wheel of the year
6 dlonS RoSi ol 3 dlonS Olsngi snd 3 dlonS Gingil
Summer Solstice, it was celebrated here on Spring Equinox. As such, the associations
Solitary/General—Snling Equinox iS s fxltility cxlxblstion of thx lifx. rloB cultulx to cultulx, Bxsltsinx BovxS xithxl dilxction on thx w by 45 dxglxxS. MoSt oftxn, whxn it wsS not cxlxblstxd bxtwxxn Snli SuBBxl SolSticx, it wsS cxlxblstxd hxlx on Snling Equinox. AS Such, bxtwxxn Bxsltsinx snd Snling Equinox SoBxtiBxS cloSS. Gxnxlslly Snling Equinox snd Bxsltsinx cxlxblstx fxltility in sll oldxlS. How StlxSSxS huBsn fxltility snd Snling Equinox cxlxblstxS thx fxltility o not with them. NoH fisslmybelfchuckhng sythosecuxtomeri.Ysx, sueegsxandbtnny rabbit imagery is aneociatedwithfertihtyand with birth, but this Holiday does not just mark the rebirth of Summer and of our Lady. It also marks the death of Winter and the
Liber ab Sol (Book of Sun)
and death, neither existing without the other. It see ms only naturolthat wunould decorate those gravesites with the symbols of life.
mark the rebirth of Summer and of our Lady. It also marks the death o cycle of rebirth beginning for our Lord. Here, we see again the connec and death, neither existing without the other. It seems only natural tha rate those gravesites with the symbols of life.
Sometimes called Children’s Bealtaine (or Beltane), this Holiday ebration of animal fertility, it is a celebration of the common result of children. Donations to charities that serve children are most appropria are presents given to children of all relations. Chocolate and other can sgyrmeatogisftos. Reemseemasboenr athreatmcohsildarepnpraorpernaoet .onolyr aobleersscing toretnh,enmuo They are a blessing to the Coven/Household. Share them with your ki kids will love it as it will provide them with multiple streams of candy couple s Wiccan ways, and the other might not be to keen on the idea. This is an excel-
Couples—Because we live in a predominantly Christian culture, chance the extended family will be Christian. As such, there may well the couple and extended family. In some cases, one family might be lceonutpoepsportuccnaitny wtoaybs,riadnge theaot gaepr.mCoguplneos foecuossinegenoonnmaekingeaE. designed to promote community. Why not? After all, not only are those eggs a symbol ceoggmsmaunnicaatsione bsy nshareinrg othwonseprcrveaateiornsewsimth gthe geoxteandoendg fwamayily.o those eggs comes from the ancient practice of hunting for eggs and nuts to be given as
Coven/Household—Culturally speaking, we see public Easter egg held at local zood.Whaed e-tprwmyofshmring the truePag?n meamngofthiscelebra-of the animal fertility associated with this Holiday, but the very pra eehse eggs chies flhi eee eacieae pleceice hf egaeiag fhl eggs ead ag gifes hf feleiliey. Thdey, shie hf eee lelgese hf eeese chiigaiey egg eeld ee lhcel zhhs. reee beeeel wey hf seeliag eee elge Pegea ieeaia
Ae, bge weee ebhge eehse hf gs wieehge ceildlea? rell ahw, we ele shieweele iaside.
Bli Bealtaine
Sgiiel is ee eee yhgee/Meidea seege. riaeel is eaeeliag eee filse that rests in the middle of Spring Equinox and Summer Solstice.
Also known as: Beleeae, Cyaeefya, Mey Dey, Mey Eve, Lhvel’s B Beeleeiae, Rhhdiess, Ceeseieeia, relpglgis.
Date: Applhxiieeely Aplil 30ee hl Mey 1se, eeis Hhlidey is ecegelly f eeee leses ia eee iiddle hf Spliag Eqgiahx ead Sgiiel Shlseice.
God associations: Bile Celagaahs Helae Pea.
John s Wort, Rose, Rosemary, Woodruff, and all flowers in bloom.
Goddess associations: Gleea Ledy.
Bealtaine Incense
148 A Wiccan Bible
2 parts Gum Arabic
Bealtaine Incense
4 parts Frankincense
2 parts Gum Arabic
2 parts Sandalwood
1 part Jasmine
1 part Rosemary
Bealtaine Oil
8 drops Frankincense
6 drops Rosemary
4 drops Rose
1/2 cup base oil
the year are split. The line is drawn on the Wheel of the Year between Bealtaine and
Solitary/General—Bealtaine is a fertility celebration of the third the first Holiday of Summer in the same way Samhain is the first Holid a result, Bealtaine is sometimes cited as the point where the Light and the year are split. The line is drawn on the Wheel of the Year betwee Samhain. However, keeping with the theme that the Holidays are mar their season and observing the fact that we see rather clear lore tha celebrated at different points on the Wheel, most notably at Spring E
More than ano olhotassocioilon.nh inisoicelahontionoelium anl'erti hty.qut do nod this day. Thus, rather than drawing a line from the day of Bealtaine to th so sepaoase Summeo and Wtnseo, I doaw soe ltne 45 degoees eaolteo, se seasons as soe begtnntng of soe cealsatne season.
Mooe soan any osoeo assoctaston, sots ts a celeboaston of ouman feo confuse soas feostltsy wtso sex. Ceosatnly, sex ts an aspecs of sots Holtd tgnooed, bus woen we say Wtcca ts a feostltsy oeltgton we mean only so symboltc sex (otsual) so tllussoase woas ts oeally gotng on. No mooe ts Rtse a oefeoence so sex soan ts ts a oefeoence so soe unton of asoame oeal Goeas Rtse tn Wtcca ts soe mtngltng of souls, and soe oeal feostltsy Couples— wotco comes foom soe mtngltng of soose souls. Is ts tn soas oodeo of oecetve soe otdden knowledge of soe magtckal cotld, soas wotco ts conc nos a poystcal mantfessaston of feostltsy (a baby), bus soas wotco ts feos Toas, my fotend, ts woas cealsatne ts all abous. Love tn soe oodeo of oo
Couples—Fao be ts foo me so dtcsase love spoos oo soe way soas soeto mtnd and soul wtso soeto body, bus I wtll make suggesstons tn so undeossand soe nasuoe of sots Holtday. Yes, ts ts assoctased wtso sex assoctased wtso soe coase and game of couossotp. Is ts a playful Holtday mtnd, I suggess soe followtng spoos. Howeveo, feeltng veoy muco soas be bold, visit your local adult bookstore and bring home a few games designed for you
Liber ab Sol (Book of Sun)
e game of tag. Set e time limit and then stand lacing each other.one partnerthe chased and the other the pursuer. The chased is given a head start and the game begins. If the be bold, visit your local adult bookstore and bring home a few games and your partner. If you want something a bit more modest, find a pub a game of tag. Set a time limit and then stand facing each other, one pa and the other the pursuer. The chased is given a head start and the ga pursuer can catch the chased within the designated amount of time, t If not, the chased wins.
Ah, but what does a person win? Be inventive with love sport. Per ing to a more private and preferably legal location, the looser lays com less as his or her lover provides pleasure. It has been my observation t relationships with any degree of shared empathy, this prize causes bot winners. If the lover’s sport leading to this suggestion of reward doe taste, consider making sport of the reward I suggested.
Ask your partner to lie completely still and completely sky clad on light touch and kiss, see if you can’t get your partner to move. If s/he d her own accord, switch so you are the one attempting to remain motio has no point system or designated method of conclusion. You will kno you both toss out the rules.
Another simple love sport is for two lovers to stand clad only by conversational distance from each other. Looking directly into each ress each other’s bodies without actually touching each other. Imagine prize was predetermined.Alternftivdla,ouncen hoawaywiththeiSkaofe ртігпог point system andsimoly aliow thisaneneloendai dadtrh onellioted prior.
epelnbuneennlefmeomnnlelnpmleoolubneeleolmemlenh,nlmlnnynlwnl.eehnlleehmnlnmlelseenlpns.nlesellwn.lsneslrnnltllepn nections romantie ,n nature.wtanewrhavAmene, vn weliao thr tonnynliyns others have made. If youi Wrolherorrrttor hasehiidneh Outyoit do^cot““ler irrfen4e“o baby-sit for this Holiday such that s/he can enjoy love sport with his or her spouse.
Coven/Household—Of riteoi, Bitlet.ni .o nie jtoe tbite htv.nu o nire.ino, eiotne.r .n ntetei, yh.rh yi htvi otti, to yill to ehi ri htvi otti. If lite beiehie ie o.oeie hto rh.ltein bte lit ti nie, rin btbl-o.e fie eh.o Hil.ttl otrh ehte o/hi rtn injil livi oiiee y.eh h. Mtki .e rlite .n lite iffie.nu ehte lit ytne ehio ei htvi t eiotne.r i rilibetei t oirint Ch.ltein’o Bitlet.ni y.eh ehi.e rh.ltein. If lit lite iyn, etki eteno y.eh tniehie eioiino.bli ritili.
Summer is at her mature/Mother stage. Winter is entering the second trimester.
Summer Solstice ummer o stce
Stooie .o te hie otetei/Miehie oetui. W.neie .o ineie.nu ehi oi God associations: Jahnis, Mannan, Puck.
Also known as: Albtn Hif.n, *Biletni, L.eht, *M.totooie, Vioetl.t, Gemstone associations: Emerald, Jade, Lapis, Tigers Eye.
150 A Wiccan Bible
der, Fern, Frankincense, Gardenia, Ivy, Lavender, Lemon, Lemon Balm, Lilly, Mugwort, Oak, Orange, Rose, Rosemary, Saffron, Sandalwood, Thyme, Vervain, Yarrow.
Gemstone associations: Emerald, Jade, Lapis, Tigers Eye.
Plant associations: Apple, Benzoin, Carnation, Chamomile, Daisy, Dra der, Fern, Frankincense, Gardenia, Ivy, Lavender, Lemon, Lemon Balm Oak, Orange, Rose, Rosemary, Saffron, Sandalwood, Thyme, Vervai Color associations: Gold, Green, Yellow, White.
* Summer Solstice is an example of how the traditional Holidays so around. There is clear indication that Bealtaine was celebrated by som the Wheel as is Midsummer, whose name is sometimes seen to deno the two seasons, Winter and Summer, or to Lughnasadh, which is fou of Summer with the view of the year as having four seasons. Additional into play when we consider the fact that Lughnasadh is often cited festival. Again we see the reason each Sabbat should be considered a spokes, ending on the day typically marked by the spoke of the Whee
1 part Dragon’s blood
Summer Solstice Incense
4 parts Sandalwood
1 part Benzoin
1 part Dragon’s blood
Summer Solstice Oil
8 drops Orange
Solitary/Gen4rar—Summon Solstice is the longest day of the year. As such, we revel in the Sun but alsocelpbraaeits dwindling. This day is a day to say thank you for all the 2rdropsrOrange
as seen in Babylonian and Sumerian lore, in some parts of the world this is the peak of
Solitary/General—aummerraolbticeribrtherlongebtrdayrofrtheryear.r inrtheraunrbutralborcelebrateritbrdwindling.rThibrdayribrardayrtorbayrthan thingbrthatrtheraunrbringbr(growth)rbutralborwhatritrdoebrnotr(draught). abrbeenrinrBabylonianrandraumerianrlore,rinrbomerpartbrofrtherworldrt therbarrenrbummerrmonthbrwhenrbwelteringrheatrdebtroybrcropbrandrv werdornotrgenerallyrexperiencerbuchrbolarrdebtructionronrarregularr definitelyrbeabonbrinrwhichrdraughtrandrexcebbrheatribrabundant.rInrbuc peabrk.brrMarcuecherlirkaerWoninr toerrmraaorlbrticeerrceenlerborarteberrtheearwraaxninrgrroafruthgeraraubnrrbeecrbau arhardbhiprthibrHolidayrcelebratebrtherwaningrofrtheraunrbecaubertoor arhardbhip.rAtrthermomentrofrimbalancerwercelebratertherreturnrtorb
Couples—Couplebrwibhingrtorconceiverbhouldrmakerloverinrarfertil woman’brpartnerrnotrberablertorjoinrherrinrthibrriterbimplyrwalkingrin baidrtorimproverherrchancebrofrconceptionrlaterrthatrnight.
can well imagine, the season itself has probably provided the fire, so why not take it upon yourself to provide the water? Gatherings around swimming pools and other spots
Liber ab Sol (Book of Sun)
ice cream make wonderful deserts for this celebertion,aodoeo lemon Italinn ice.
If the summer heat is not enough or if you want the visuals of a fire, the evening will upon yourself to provide the water? Gatherings around swimming pool where a person might cool off and restore balance are very appropriate. ice cream make wonderful deserts for this celebration, as does lemon
If the summer heat is not enough or if you want the visuals of a fire, be greatly complimented with a roaring bonfire, drumming, and da hosts and hostesses should pay close attention to their guests’ hydrat hot weather injuries. Remember that ritual is sacred theater that cel and as the heat is very real it will be an influence on your ritual. Should particularly hot, rites based on the story of Persephone are appropr spect to which side of the equator one finds oneself. This is a wonderfu children as to the importance of balance.
Summer is at the senior/Crone stage. Winter is entering the third trimester.
Also known as: Ceresalia, Elembius, First Harvest, Lad Day, •Midsummer, Lammas, Lughnasadh
Summer is at the senior/Crone stage. Winter is entering the third day that rests in the middle of Summer Solstice and Fall Equinox.
Also known as: Ceresalia, Elembius, First Harvest, Lad Day, *Midsu Thing’s Tide.
daay et:hatprpersotsx imn athee ymiuddyle osf ,Suumgmuser Ssolosrticen a,nd FsalloEquaiynosxa.cu Apple, Frankincense, Ginseng, Grapes and Grapevine, Heather, Lavender, Pear, Potato, Sloe Berries.
Color associationseGreen, Oracge, Red , Yellow.
* See Summer Solstice
Lughnasadh Incense
4 parts Frankincensa
* parts Lavender
1 part Heather
Lughnaradh Incenre
Lughnasadh Oil
10 drops Frankincense
10 drops Lavendir
Lughnaradh Oil
their book Eogds Sabbses forWitches, the Farrars tell us the translation is ’the com-
10 dsses Lnveldes
believe Wicca is a world religion, but as this is the name so many use to note this Holi-Sali,ary/seneral—Ie ls lliely ehe lnme Lughlnsnbh hsmes fssm e
Lugh is sometimes called Lugh Samhioldanach, which means ’Lugh of the many
152 A Wiccan Bible
Although Winter Solstice and the cultural gift givingseasonin sSsilseveral months off, this is an excellent time to incorporate crafts into one’s Holiday activities. The weather
Lugh is sometimes called Lugh Samhioldanach, which means ’L arts.’ Other times he is called Lugh Lamhfhada, which means ’Lugh o thits iosuagn excenllteenrt toimste cteo ainncotrpeorcautetucrraaftgs itntgovonnge’sseHasoolnidasysatctisveitv is good enough that spending long hours looking for pinecones acorns a materials to make Yule ornaments and gifts will be pleasant and fruit spending a bit of extra money on a nice dinner or entertainment with the theme of
Couple—Love sport is most appropriate to this Holiday, especially a chase theme. This Holiday often marks the first harvest, the first c after a season of tending to the crops (chase). Even if finances are spending a bit of extra money on a nice dinner or entertainment wi ushering future harvests is an excellent way to include sympathetic sp rite. Remember, like attracts like. Lughnasadh celebrates much more ios ttheedaey o.n twhsicahsothteefirstto Wt ieccmanarrritaegoefaHnanedrftasttiny gr itsebs aosedutgheadn marriages which are trial marriages that could be undone by return will be like. With that information, one can begin to judge what the Winter food supply spo aer a year an a ay.
Coven/Household—This is a time of introspect for Covens and H first harvest has been taken in and from it one can begin to judge what t will be like. With that information, one can begin to judge what the Wi will look like. Although most of us do not live directly off the land, principle is that wliuaonplacenrealhv.fmodernlioiisahdld oraooen has certain monetary requirements. Asheating billsrrso,housohold iiicomeclecreeseb.Sooistlie wul-tionaooy toat woiro a rolen or oouceoood requirec to curlile toat w discuss pooling rcuuuoces,mcybeseStingassdn cuvenmomes-houSC оає тетСегІтС piieripoe ic -on- eoee oee fnrec ienoi-y, n eodeie oouceoood oi rolee e-nit iequiieees-c. Ac oen-isr biooc iice, oouceoood iscoee decience -uino Hooidntc eioo be upos uc, nsd oui iscoee eioo be -nxed. Toic ic diccucc poooisr iecouicec, entbe ce--isr ncide coles eosiec coouod o
Hoc-isr puboic fec-ilnoc is oidei -o inice cnpi-no foi cuco eles-unoi-cnpi-noic-ic.
Summer is at the death stage and begins the cycle of rebirth. Winter is reborn.
Fll Ei
Fall Equinox
Sueeei ic n- -oe den-o c-nre nsd berisc -oe ctcoe of iebii-o. Wis on the day when the length of day and night is equal.
Also known as: Aobns Eofei, Hnilec-, Mnbos, Fec-ilno of Diostcuc, Wnssr Equsox, Wse Hnilec-.
Plant associations: Acorns, Apple, Aspen, Corn, Cypress (especially cones), Frankin-
Liber ab Sol (Book of Sun)
Pine (especially cones), Sandalwood, Wheat (especiallystalks).
Color associations: Brown, Orange, *Purple, **Yellow or White and Black (together Plant associations: Acorns, Apple, Aspen, Corn, Cypress (especially cense, Grape, Hazelnuts (and to some extent all nuts), Hops, Juniper, Pne (especay cones), anawoo, Weat (especay stas).
Color associations: Brown, Orange, Purple, Yellow or White and
* Purple is an association if observing this Holiday with its association ** Yellow or white to represent the day with equal amounts of black night. Each is appropriate only with an equal amount of the other.
Fall Equinox Incense
1 part Juniper berries
4 parts Frankincense
2 parts Sandalwood
1 part Cypress
1 part Juniper berries
Fall Equinox Oil
6 parts Frankincense
6 parts Sandalwood
4 parts Cypress
2 parts Juniper
before Winter. It is a time of meditation and thought. How has the year gone? What Solitary/General—We find ourselves again at a seasonal balanc nights are equal, and the second harvest is in. Feasting is welcome, advised, as this is a day of balance. Remember that there is only o before Winter. It is a time of meditation and thought. How has the y will be needed for the pending Winter?
It is also a good time for the Solitary to find community. The nigh and longer for each of the next six months. With those long nights com aoruorunod thees cgovrenerntaonsdemasionndas teandectot vteurn sinowraerrd. if theeycuhatuverano polacea That is to say get out of the house because in just a short time it will be It is also a time for the general community to find solitaries for the sa school aged children. It is the first one after their children s Summer vacation. While Couples—When someone thinks of Wiccan holidays, they typical moon and bonfire late at night. Now I am sure everyone loves a g moonlit evening, but there is something very special about this holid school aged children. It is the first one after their children’s Summer ttoaptamregntst.nAost sseuecmh thies mis uacn exocretlleonstedwayt foorutbcoth praerne,ntsamto ttoake tof
tional part of European lore, today it is a staple. As such, if you should live in a region where corn is ready to come in, kettles and grills can be used to create a veritable corn
154 A Wiccan Bible
without shucking them and place them on the grill. If ywudanoBhbve access to seawater, mix sea salt with fresh water and soak away. Then make it a feast of shucking as you where corn is ready to come in, kettles and grills can be used to create feast. If you can, find a farmer willing to sell whole stalks. Soak the without shucking them and place them on the grill. If you do not have ter, mix sea salt with fresh water and soak away. Then make it a feast o eat.
Ah, but what of the stalks? Although we are still a month and a Samhain, we are only a day until the season of Samhain begins. Wh

Liber ab Luna
Liber ab L
(The Book of the
or The Book of Twelve, Part I

started the research for this chapter what seems like decades ago. Someone asked me why it is that Witches’ covens have 13 members. I explained the idea that a Coven must have 13 members is a myth. Sure, it was perpetuated in the early days when Wicca was first being introduced, but the word started the research for this chapter what seems like dec one asked me why it is that Witches’ covens have 13 mem the idea that a Coven must have 13 members is a myth. Sur ated in the early days when Wicca was first being introduc coven is simply a spooky term for a collection of kith and cific number is just a misconception. The research started asked why there is a perception that Witches’ covens have
Witches, and I had no answer to give. This chapter is my answer.
In addition to the eight solar Holidays, many Wiccans mark the cyc As you recall, I mentioned the belief that the word Sabbat is probably of those spooky words invented by demonologists for the purpose o religious practices of folk who were not Christian. Perhaps you hav scary term, Esbat. Chances are, this is yet another made up term. Th tween the words Sabbat and Esbat is that one was made up a lot late
C*Oi
Wi
tch use
ke
5
understood, or slang version of the French term s’esbattre, which means ’to frolic.’ Al-
156 A Wiccan Bible
the gatherings of Witches, by the time Dr. Murray Anoountarrd theeeference she had already decided that all Witches everywhere used the word Sabbat to describe those understood, or slang version of the French term s’esbattre, which mea though Pierre de Lancre was clear in the use of that word being a gen the gatherings of Witches, by the time Dr. Murray encountered the re already decided that all Witches everywhere used the word Sabbat t gatherings. This is an important point because a great deal of what claimed was an ancient religion when he introduced his tradition to t fact based largely on Dr. Murray’s books. Rather than recognizing the ent cultures use different words to describe the same thing, she took i decide the word Esbat was another of the universal Witch words. As invent a meaning other than the one she assigned to Sabbat. As she word Sabbat was a reference to a holiday, then Esbat must be a wo origin in a word denoting frolic. Eventually, maybe via Gardner, the note were marked by the sun probably lent itself well to the evolution of th marked by the moon. Today, many folk use the word Esbat to refer to In the Book of Sun, I said the Sabbats are better termed holidays the Esbats are better termed meetings. Although not nearly as spo words, they do convey meaning much better. It’s not really a hard co household/coven celebrates Holidays together and it has household separate from those celebrations. Although the word Esbat was not us tian fertility religions, if a group were to schedule monthly meetings
and celebrationsl Infact,alarho emounioflunarlore hrsccmetobeconnodiedwith the eight solar liolidayo.Althoiigliit megheseem ohonkiiinoaltlioiiehwo celentatu the eight solar holidoyoondrtos eeterminedby theEarm’utravel around the Sun, that Thit it nur ru t,c rh,r Wicc,nt lu nur o,eI rhe ccctet us rhe Mu ,nl eetece,riunt. In s,er, , t,ete ,ouenr us ten,e tuee h,t euoe ru ce rhe eithr tut,e hutil,ct. Atrhueth ir oithr teeo thueIint, ,trhueth eithr tut,e hutil,ct un l,ret lereeoinel cc rhe E,erh’t re,vet ,eue euneepr it nur ex,ertc eniveet,t. ihit it outr nur,ctc wirh y,oh,in ,n suee rhe ouleen P,t,n ouveoenr leeilel ru pt,ee y,oh,in cerwee nux ,nl Winree yuttriee, irt l,c us eetece,riun w,t o,eIel cc ten,e peiue ru Be,tr,ine ceint o,eIel h,ts w,c cerween ypeint Eqeinux ,
New Moon
Full Moon
Dark Moon

The Lunar Cycle—One Month
Chances are you will not often find a similar association to our Lord. Instead, you are more likely to see a solar cycle assigned to our Lord. Looking at popular books on
The Waxing and Waning Moon
Gods. Historically speaking this simply has not been the case. There have in fact been
Chances are you will not often find a similar association to our Lo
Wicca, one might think
Moon God |
os. storcay spean many masculine personific |
g ts smpy as ations of the mo |
not een te case. ere on and moon gods. |
Aglibol |
Middle East |
Menu |
Middle East/ |
Amm |
Some of the Many M |
oon Gods |
Mediterranean |
Aningan |
Moon God Origin |
Meness |
Moon God Origin |
Apocate quil |
South America |
East |
Central Europe |
Arebati |
Amm Middle |
East |
enu Meditee |
Arma |
Middle East |
nd |
Meness Central |
Avatea |
Aningan Greenla Apocatequil South A |
merica merica |
Near East |
Chandra |
Near East Arebati Africa |
Metztli North |
|
Fati |
Arma Middle |
East |
Nannar Middle |
Gou |
Africa |
ian Islands |
Napir Near E |
Ilmaqah |
Avatea Polynes |
aiastn Islands |
Si Sh |
Igaluk |
ian |
Sin Middle |
|
Itzamna |
Fati Polynes Gou Africa |
Tecciztecatl |
Soma Near E |
Jarih |
Middle East |
East |
Ta’lab Middle |
Jayce |
Ilmaqah Middle |
orth America |
South America |
Khons |
Igaluk Arctic N Itzamna Central |
America |
Tecciztecatl North |
Kusuh |
Jarih Middle |
EAamsterica |
Terah Middle |
Mah |
Middle East |
merica |
k Sh |
Mao |
Jayce South A Near East |
To make matters just a bit easier to express, for the rest of this chapter I will pro-
158 A Wiccan Bible
this calendar was institutionalized in 1582 by Pope G regoryXIII,itie still in use today. It makes the best base point for discussion. However, when we are discussing matters
To make matters just a bit easier to express, for the rest of this ch vide approximate Gregorian dates for the days and months being disc this calendar was institutionalized in 1582 by Pope Gregory XIII, it is It makes the best base point for discussion. However, when we are di that span about 140,000 years, a calendar that is little more than 4 present a few problems. So please do not consider any of the dates giv in stone. I have already pulled out entirely too much hair trying to pres tion in an understandable way to argue the virtues and vices of using a tionalized by a Catholic Pope.
In the Middle East, a god was associated with each of the years moons (each month). The following are those gods presented with the name of the moon they are associated The Hindu Calendar
moon gods sometimes appear with a few alternative names. The most common are:
In the Middle East, a god was associated with each of the year’s moo The following are those gods presented with the name of the moon th with and the modern approximation. Collectively known as the Ad moon gods sometimes appear with a few alternative names. The mo Ansa, Aryman, Bhaga, Daksha, Dhatri, Indra, Mitra, Ravi, Savitri, Su
Winter Solstice

The Hindu Wheel of the Year
Month |
Gregorian Start |
Gregorian End |
God |
Pausa |
Libe |
r ab Luna (The B |
ook of the Moon) |
Magha |
January 21 |
February 19 |
Bhaga |
Chaitra |
Month Gr |
egorian Start G |
regorian End Go |
Vaisakha |
Pttit De |
remser 22 Jt |
tttry 20 Pt |
Jyaistha |
ttght Jt |
ttry 21 F |
srttry 19 Bh |
Asadha |
Chtotrt t |
rrh 22 A |
,rol 20 Voi |
Shravana |
Vtoitiht A, |
rol 21 t |
ty 21 Ar |
Bhardra |
Jytoitht t |
y 22 Jt |
te 21 Vov |
Asvini |
Aitiht Jt |
te 22 Jt |
ly 22 Am |
Kartika |
shrtvttt Jtl |
y 23 A |
tgtit 22 Ptr |
Agrahayana |
Bhtrirt At |
gtit 23 se |
,temser 22 Vt |
Phalguna |
Aivoto se |
,temser 23 O |
rttser 22 Iti |
* 21 on leap year.
So just why is the moon found in so many different religions? The most obvious * 21 on leap year.
ence of a thing is all it takes for religion to address its existence because that’s one of the primary functions of religion. Religion, science, and magick were for a time inseparable subjects. Theysorestpahytedhe mowenftrucdure styatCido’fhaecmech l';iit.її іт the religion they lined to asserttheir authority.hearingscioncemightsome hayprcve the earth was notthecenter oCthvuniverreiihay made tCehrlioroniriv (suneCrentert
the primtry ftnrtitnt tf religitn. Religitn, trienre, tni mtgiri eere f rtsle itsjerti. .hey eere ieptrttei sy pteer itrtrttrei thtt ioin’t ht the relogotn they tiei tt tiiert theor ttthtroty. Fetrong iroenre moght the etrth eti ntt the renter th the tnoverie, they mtie the helotrentro voee th the tnoverie ollegtl tni omproitnei oti tetrheri. It oi ntt tn time before Newtom,emmeoneobsepevd tocitirt oceav’stieo eoseand fell with the
Liielirienre,ltnelthlthelrtleilthlreligitnliilttlexpltinlehylthing tides of menstruatien teemedioAO meandno hithmartous stametce taamoyn,bcthon a monthly cycle.
tome sehtre Neettts itmette tsiervei thtt the trett’i toie rtie t ryrle th the mttt tti itmette itoi “.htt oi gtiieiis” serttie they t toiei th metitrtttott ieemei tt rtme tti gt eoth vtrotti ittgei th th t mttthly ryrle.
Frtm tsiervotg thtie ryrleis t ,tttert emergei tt rtm,lomett the mer tti Wotter. .htt ,ttterts the ltttr ryrleis iervei ti t ,romotov ,romotove serttie ti ee eoll ittt iees the rtletitr eti ttt tll thtt trr days long, but let’s use modern science to be a bit more exact: One day is 24 hours, or
160 A Wiccan Bible
708.744 hours, or the amount of time it takes for anyonenliBseoe the moon to be repeated, dark to dark, full to full, new to new or any portion thereof.
days long, but let’s use modern science to be a bit more exact: One da the amount of time it takes the Earth to rotate once; one month is 708.744 hours, or the amount of time it takes for any one phase of repeated, dark to dark, full to full, new to new or any portion thereof
One year is 12 months, so to find the length of a year we can take tiply that by 12, and we should come up with that familiar figure 365 exactly what we would come up with if there were indeed 12 months there are not. If there were, the year would be 354.372 days long. W other 10.62 days? Wouldn’t they accumulate and wind up adding an ex 2.78 or so years? They would, which is why the lunar calendar is not th tracking annual events. It is, however, an excellent tool in tracking mon a modern calendar is not available. One needs only look into the sky idea what time of the month it is.
But instead of adopting a strictly solar calendar, attempt after atte justify the Moon and solar cycles. Now, many of them were rather ing were ideal for the masses that did not possess a level of education tha understanding. So chances are Murray, in inventing the modern use of t and Esbat, was on to something after all. Not because either word ancient Pagans, but because once a year events (celebrations) were b solar calendar, and routine things, matters of kith and kin, were best current 12 months or the year. Although those months were definitely fashioned on the many attempts tohynchronizetWe munawmonyhf witlithesolaryear, ourmodem oy the soear taeeydar ayd private or smaee group teeebratioys someti eiee mtty. Biz iy cooiyg zhoz, peyocy it ytz ttyeicy zhy iiyo te o eiyo tirryyz 12 mtyzhc te zhy oyor. Aezhtigh zhtcy mtyzhc wyry iyeiyiz zhy moyo ozzympzc zt coythrtyizy zhy eiyor mtyzhc wizh zhy cteor o toeyyior ic o czritzeo cteor toeyyior wizh ytzhiyg mtry zhoy zhy yomy
mtyzhc. Ftr yviiyyty te zhic eotz, jicz ettk oz otir toeyyior oyi yt
This is why the so-called ’Celtic Moon Calendar’ of popular-Pagan culture seems to change from book to book. Even if we set aside the fact that the Celts were a vastly
The Celtic Moon Calendar
but for the gods and goddesses themselves and also set aside the difficulty in determin-Thic ic who zhy ct-toeeyi ’Cyezit Mtty Coeyyior’ te ptpieor-Pogo start? Although at miontt eemlikek no-bruinertyat t.he toloc yt aetlartz atWinter Solstice, we have totemtether thattheWmtetSoOsricewasnot marked bytheancient Celts.
To make matters even more maddening, I am sure you have heard Samhain called
Liber ab Luna (The Book of the Moon) been referenced as Cetsamhain, which mr ans oupnssiteSamhain.Nowtwekrwwnhat Bealtaine moved about on the calendar by about a month and a half in either direction,
To make matters even more maddening, I am sure you have heard the Celtic New Year. Well, Samhain’s counterpart is Bealtaine, whic been referenced as Cetsamhain, which means ’opposite Samhain.’ No Bealtaine moved about on the calendar by about a month and a half in so it stands to reason that Samhain—which is ’opposite’ Bealtaine on t Year—also moved around a bit. Does anyone really believe that the dated the placements of these celebrations? So then, if the names gi cycles are valid and are in the right order, where on Earth would w them? Let’s say the Wolf Moon is the first moon of the year. Is that the the Winter Solstice that the ancient Celts did not mark? Or is it the Samhain, which could occur more than a month prior to October 31s ter? Is there an answer?
I think the answer is that it does not matter. A far superior ca invented, and that calendar is so ingrained into our culture that it will long time. However, for the sake of discussion I will share how I count
Winter Solstice

The Celtic Moon Calendar
Moon Count |
Name of Moon |
Pop Pagan Month |
First New Moon |
A W |
iccan Bible |
Second New Moon |
Storm Moon |
February |
Moon Co |
unt Na |
me of Moon Pop Paga |
Fiast Ndr |
Muua Wu |
lr Muua Jnaynaa |
Sdcuaa N |
dr Muua Stu |
am Muua Fdbaynaa |
ehiaa Nd |
r Muua Ch |
nstd Muua Mnach |
Fuyath N |
dr Muua Sdd |
a Muua Apail |
Firth Ndr |
Muua Hn |
ad Muua Mna |
Sixth Ndr |
Muua Pna |
tada Muua Jyad |
Sdvdath N |
dr Muua Md |
na Muua Jyla |
Eighth N |
r Muua Wu |
at Muua Aygyst |
Niath Nd |
r Muua tn |
lda Muua Sdptdmbd |
Eleventh New Moon Snow Moon Novembe
Twelfth New Moon Oak Moon Decembe
month. As a lunar cycle is a month, I do not entertain such nonsense. Instead, I just set aside those 10.62 days and don’t give them a name. Or I say they are part of the Blue Ah, but what about the Blue Moon? Well, that is a tough one. Mo again. The Blue thaon ie thustMe fullhmar cycleonthnsoOecyeaaShntbegmnwfth tie thirteenth new mmunof Ason atynarand canlm iulhat tamnsolaryenr.tStcnnUan exact aside thuse 10.62 days and dun’t give them a name. Or I say they are Muun thnt uccyas eveaa 2.78 ua su aenas nna I nm snving them yp yntil ngnin. The tlye Muun is thys the ryll lynna cacle ur the sulna aena thn ThreCeltic Tree СаПугкУаг
sastem, byt ns auy nae nbuyt tu aiscuvea it is ns guua ns nna.
Another interesting calendar found in pop-Pagan culture is the Celtic Tree Calendar. It is sometimes called the Druid Tree Calendar or the Ogham Tree Calendar. Like
The Celtic Tree Calendar
not misunderstand my position. I am not convinced the tree calendar is bunk at all. I Anuthea inteaesting cnlenana ruyna in pup-Pngnn cyltyae is the Ce ana. It is sumetimes cnllea the Dayia Taee Cnlenana ua the Oghnm Tae mnna things nauptea ba the Pngnn cummynita ns rnct, this is nlsu spec nut misynaeastnna ma pusitiun. I nm nut cunvincea the taee cnlenana jyst aun’t believe theae is signiricnnt histuaic rnct tu believe it is entia paesentea.
Tree Calendar has beenpidmlyyhrlSnngeddy current tcademia in iOidior\hd hooktle the sybject within the Pngnn cummynita, The White Goddess ba Rub was put forth to support the Tree Calendar, the poem itself has been embraced by the
Liber ab Luna (The Book of the Moon) beloved Janet and Stewart Farrar. Despere thedifferenceenoomioobetweenthe )a-gan and academic communities, I feel the Tree Calendar deserves a place in our com-was put forth to support the Tree Calendar, the poem itself has been Wiccan community. Most notably, it has been included in the rituals p beloved Janet and Stewart Farrar. Despite the difference in opinion gan and academic communities, I feel the Tree Calendar deserves a p amdudnrietsysainngdnboetlioenvley tithsesiunpfpoormrtaetrisobnupt raelssoenittseddehterarectworilsl. hWelipthttohfautrgtohae theories about the ancient Celtic year.
noted that this system is also the most often cited in the Pagan community. It is a 13-
The Ancient Celtic Tree Calendar (Theory 1—The lea lunar cycle to the solar cycle. The last day of the year is seen as a day outside of the year, Presented as the first theory is how I received it as a teen. Since t noted that this system is also the most often cited in the Pagan comm part division of the year with an extra day or two at the end of the y lunar cycle to the solar cycle. The last day of the year is seen as a day ou and while this may be confusing, calling that day a day is not very accu a couple of days depending on how the solar year and lunar months lin source of the Wiccan term ’A year and a day.’ Most claim it means one and a day (1 day) for a total of 366 days. It is actually a Celtic year (ap days) and a day (approximately 1 day) for a total of 365 days or mode
To add just a bit more confusion to the matter, Samhain (Grego tion October 31) is often cited as the Celtic New Year’s Eve with Nov marked at concluhiofiWedaeo dihferwel story iiiiloldiiiu.II’t.h;it.isho\e we adfresothc months, we see thotamore accorate wry of aknooschingOhemonthe nOthe CeltecYe or would be to start at tfefirttn ew monnofter Falinquiiiox.yiiylCel netheccoe.eliefirst consitew SCmhCin io Ie C single tCe. InsieCt, iy te consitew ii io Ie mtwket ti concltsion, te see t tiyyeweni siowe tnyolting. Iy ihti is hot monihs, te see ihti t mowe tcctwtie tte oy tppwotching ihe monihs o Whichever youchoceetlhavearrangwd the charriodefticttheCehic Trca Celam dar starting with mottrfor hee reiisoi^kircLBctr itmotI.reprwfeyl.otivee I’.kini c.y, yewsi tte oy ihe net eetw es ihe tte tyiew Sthhten, ihen te totlt s month es Rtes.
yhechelew eot choose, I htle twwtnget the chtwt to tepect the we ttw sttwteng teth Beth yow tto wetsons. cewst, Beth es most wepwesentt tnt Jtnttwe es thewe te sttwt the net soltw eetw. rhe secont, tnt pewh tteneng wetson, es thtt ey te choose to celeele thtt tll those Ptgtn Stmhten ceeng the weltec Net Yetw tnt te choose to celeele thtt marked day (SolrticeotEquinox) ace e tenae-myrkeh day (nowmoonolinmc uep eft rwee wtlenttw, te twe yowcet to tccept thtt thech Rocewt ewtles ts pwemese, “rhe Saag oy Selen renes.” In toeng ahaa, ahe yewsa monah oy


///ПІН P f// Hill
В - Beth
L - Luis N - Nion O-Onn F - Fearn
S - Saille
H - Huath D - Duir U-Ura T - Tinne
C - Coll Q - Quert
E -Eadha
G - Gort
Ng - Ngetal
Ss- Straif
R - Ruis
I - Idho
A - Alim
Ph - Phagos
Idho/Winter Solstice
Eadha/Fall Equinox

Опт/Spring Equinox
Ura/Summer Solstice
The Celtic Tree Calendar
The Celtic Tree Calendar
Gregorian December 24th, then the dates given will be reasonably accurate. Should that not be the actual day of the first new moon after the Winter Solstice, well...you have some math to do.
Bn. the CeIticTuee anileiiceribmii41imoretlienawag vf keeping track о f ahe mouthsm oyear. h findeedi tie ac eatuaa ancient calendar, thyniners owrlieenformlitir awaitteclan-ry.
eithercreated or recBivedthcrecreTtwwguage.Each menih od thHyear.hhe four Qwprtersof thnyeor, ond ehoee otherkeypointr have a name, assaeiated trae,endl etiwein theO-ham alytab et . Although that algUagetmawboloosalyitanrratydto ouootoC-ern alphrbet, thelstterrof thrOahem a^eqohe^bhid^feu^^i^'t. Following a straioht line mwyedoestoae,lho OehamreSiefs cotsistol'strok є8-оєПУієг rideorccrosr thestraightime.ldore thEt thhOgham grewefterots introduction.Hwnclnhesoaveri sions ofOgham havebeondwe colaled, altdwstoWOumsobae few Fyaayweeg a httaegot aeer ee wyyr yt htyerl to
The Ogham
The Celtic Tree Calendar at a Glance (Theory 1—Least Accurate)
Month |
Tree |
Liber ab Lu |
na (The Book o |
f the Moon) |
Beth/Beith |
Birch |
December 24 |
January 20 |
В |
Luis |
The Celtic Month |
Tree Calendar at a Tree G |
Glance (Theory regorian Start |
1—Least Accur Gregorian End |
Nion/Nuin |
Beth/Beith |
Birch D |
ecember 24 |
Januar 20 |
Fearn |
Luis |
Rowan Ja |
nuary 21 |
February 17 |
Saille |
Willow |
(Mtn. Ash) |
May 12 |
s |
Huath |
Nion/Nuin |
Ash F |
ebruary 18 |
March 17 |
Duir |
Fearn |
Alder M |
arch 18 |
April 14 |
Tinne |
Saille |
Willow A |
pril 15 |
May 12 |
Coll |
Huath |
Hawthorn M |
ay 13 |
June 9 |
Quert/Muin |
Duir Tinne |
Oak Ju Holly Ju |
ne 10 ly 18 |
July 17 August 4 |
Gort |
Coll |
Hazel A |
ugust 5 |
September 1 |
Ngeatal |
Quert/Muin |
Apple/ S |
ptember 2 |
September 29 |
Ruis |
Elder |
Vine (grape) |
December 21 |
R |
Quarter Days:
Day |
Tree |
Quarter Day |
App. Gregorian |
Ogham Letter |
Onn |
Quar |
ter Days: |
March 21 |
О |
Ura |
Heather |
Summer Solstice |
June 21 |
U |
Eadha |
Day |
Tree Qua |
rter Day A |
pp. Gregorian |
Idho |
Onn |
Gorse Spri |
ng Equinox M |
arch 21 |
Idho
Day |
Tree Quarter Day App. Gregorian Ogham Letter |
|
Straif |
Additional days of note: |
October 31 Ss |
Alim |
Pine Last day of year |
December 23 A |
Phagos |
Day Tree Quarter Day |
App. Gregorian |
The Celtic Calendar (Theory 2—Most Accurate)
This theory ii6ost commonly accepted among scholarsbnt is blmost entirely missing from the Pagan community. Here we see a calendar reconstructed from large bronze
The Celtic Calendar (Theory 2—Most Accurate) was discovered in France. Its language is clearly Gaulish, but its letters and numbers have
This theory is most commonly accepted among scholars but is alm ing from the Pagan community. Here we see a calendar reconstructed fr plate called the Coligny Calendar. Measuring 5 feet by 3 1/2 feet, the was discovered in France. Its language is clearly Gaulish, but its letters a obvious Roman influences. The lunar cycles were counted in 19-year total of 235 lunar cycles with two extra months inserted for every 62 st was precise enough to yield only a 12-hour error after the full cycle of
The problem with this calendar is that it is anything but user frie term would be ’user surly.’ A 5-foot bronze plate is not exactly a Pal reason, I do not believe it was the calendar of the common (pagan) bCeellitesvme eaaltshuoruegdhtitmhee,CitowliagsnyprCoablaebnldyaornilsyathvealviderryewpreelsl eendtuactaiotendotfhtahte lar system.
less both right. This theory is that the older of the two calendars was the Tree Calendar
The Celtic Tree Calendar (Theory 3—The Middle Gr folk educated enough to use the Cohgny Calendar or those like it would do so to deter-
The third and least accepted idea is that theory one and theory tw less both right. This theory is that the older of the two calendars was th and that the Coligny Calendar represents a Romanized view of the C the ancient RomanCadecaar.
The Astrological C ale imlar
thr ancirnt Roman Calrndar.
Interestingly enough, we see yet another attempt to connect the solar year and lunar months in modern pop astrology. I say ’pop astrology’ because as any trained
The Astrological Calendar sign on a chart. However it is very interesting to note that there is no real reason to
Intrrrstingly rnlegt, wr srr yrt anlttrr attrmpt tl clnnrct tt lenar mlntts in mldrrn plp astrlllgy. I say ’plp astrlllgy’ brcaes astrlllgrr will trll yle, ttrrr is a grrat dral mlrr tl astrlllgy ttan lll

The Astrological Wheel of the Year
Month Name |
Begins |
The Astro |
logical Wheel of the Ye |
ar |
Capricorn |
December 22 |
January 19 |
Saturn |
Earth |
Aquarius |
January 20 |
February 18 |
Saturn/Uranus |
Air |
Pisces |
Month Name |
Begins |
Ends P |
lanet(s) |
Aries |
Capricorn |
December 22 |
January 19 S |
aturn |
Taurus |
Aquarius |
January 20 |
February 18 S |
aturn/Uranu |
Gemini |
Pisces |
February 19 |
March 20 J |
upiter/Neptu |
Cancer |
Aries |
March 21 |
April 19 M |
ars |
Leo |
Taurus |
April 20 |
May 20 V |
enus |
Virgo |
Gemini |
May 21 |
June 20 M |
ercury |
Libra |
Cancer |
June 21 |
July 22 M |
oon |
Scorpio |
Leo |
July 23 |
August 22 S |
un |
Sagittarius |
Virgo |
August 23 |
September 22 M |
ercury |
Sagittarius November 22 December 21 Jupiter
I believe the number 12 became sacred because it is the number of full lunar cycles in the solar year—not the number of Full Moons (single days), but of the full Why so many Twelves?
see, that s how Wicca sees the world in which we live—not in a collection of things (objectification), but in our relationship with those many things (sometimes by per-
168 A Wiccan Bible
further examples can be found in ancient Pagan lore,whichaells ub tee number 12 is of great religious significance. Moses led the 12 tribes of Jewish people out of Egypt.
(objectification), but in our relationship with those many things (so sonification). Therefore, the Moon was personified as opposed to o further examples can be found in ancient Pagan lore, which tells us the great religious significance. Moses led the 12 tribes of Jewish peop Jesus selected 12 apostles. Odysseus had twelve crew members. Ar lected 12 Knights of the Round Table. Modern juries typically conta and, of course, Witches Covens are often thought to have a leader and because someone looked up and saw something larger than the stars All because there is one Sun and 12 lunar cycles. All because it was th
The 12 Labors of Heracles—Roman—Mediterranean
Although it might be wild speculation on my part, 12 Labors of Her reference to a year of servitude.
Kill the Boar of Erymanthus
Kill the Lion of Nemea
Kill the Hydra
Kill the horrific birds of Stymphalis
Kill the Boar of Erymanthus
Capture the Ceryneian Hind
Capture the Bull of Crete
Retrieve the girdle of Hippolyta c umn
Retrieve the goldcntupfetfromthe gGedyoof the Hesperides
Retrieve Cerbencc frontthAUgfenvorld fSring it to the surface)
The Statue of CromCruach—Irish—Central Eerope
RftrifvfrttfrgoldfnrrpplfsrfromrttfrgrrdfnrofrttfrHfspfridfs oftrnfvfrcfrdfrusrfrlmrttfrunsfrwlrlsr(drnngrntrtlrttfrsurfrcf)
Crom as a solar deity (one solar year) with lesser deities (each lunar cycle) surrounding The Statue of Crom Cruach—Irnst—cfntrrlrEurlrf
TtfrStrtufrlfrcrlmrcrurctrttrtrlncfrstllsrnnrUlstfrrwrsrmrsfrlfrgl ttnsrtugfrstrtufrwfrfr12rlfssfrrstrtufsrmrsfrlfrstlnf.rTtnsrnsrrrldrdly crlmrrsrrrsllrrrsfntyr(lnfrsllrrryfrr)rwnttrlfssfrrsfntnfsr(frctrlunrrrcy tnm.
Gladsheim—Scrnsnnrvnrn—NlrttrEurlrf
Mfrnnngr’rlrcfrlfrgrfrtrjly,’rGlrsstfnmrnsrttfrtrllrlfrttfrAsgrrs,rw tngtrctrnrs,rlnfrflrrfrctrlfrttfrmrjlrrglssrlfrttfrrrnttfln.
God |
Goddess |
Apollo |
Diana |
Jupiter |
Juno |
Mars |
God |
Mercury |
Apollo |
Neptune |
Jupiter |
Vulcan |
Vesta |
The Olympians— Mercury Ceres
God |
Vulcan |
Hephaestus |
Aphrodite |
Apollo |
he Olympians |
Ares |
God |
Zeus |
|
Hermes |
Hephaestus Demeter |
|
poo Ares |
|
|
Poseidon |
|
Hermes Demeter
Dionysus Poseidon found that way in lore.
God |
The Greek perso |
Cronos |
Earth) and Ura |
Iapetus |
found that way i |
Осе anus |
God |
Hyperion |
Cronos |
Crius |
Iapetus |
Coens |
O |
Crius Mnemosyne
Coeus Phoebe
And yet, with all of these cultures incorporating the lunar cycles into their 12 month years, when my first book came out a fellow author took me aside and told me that I did
The 13 Moon Myth
12 lunar cycles in the year, but 13. Could I have been that poorly informed?
And yet, with all of these cultures incorporating the lunar cycles int years, when my first book came out a fellow author took me aside and t a good job on everything except the Moons. Per that friend’s observati I wondered how that could be so when just about every book outside of the Pagan com-
170 A Wiccan Bible
Instead of being predominantly concerned with the relationship of the lunar cycle, folk were concerned with the event of the Full Moon. You see, that extra change often
I wondered how that could be so when just about every book outside o munity said there were 12 and some change. And then it struck me: It i
Instead of being predominantly concerned with the relationship o folk were concerned with the event of the Full Moon. You see, that ex produces a 13th full moon in the year, but it is incapable of produci lunar cycle even if one does use new math. This is perhaps a result of in the traditional version of “The Charge of the Goddess.” you shall assemble in some secret place and
adore the spirit of Me who is Queen of all Witches. ”
“Whenever you have need of anything, once in the month, and better it be when the moon is full, yaoduorse tahe asspsierimtofeMne swohmoeisseQcueeepn aocfeaallnWitches.”
in Moon lore is that like all things, the lunar cycle has a beginning, middle, and an end.
—Author Unknown (see Book of Th and Sage, our Lady as Maiden, Mother, and Crone, but of ourselves as youth, mature,
Whatever the reason, the Full Moon is only part of the story. The in Moon lore is that like all things, the lunar cycle has a beginning, mid

Liber ab Solemnitas
Liber ab Solemn
(The Book of Holidays
Or tire Book of Twelve Pail II
fne of the reasons I do not buy into the romantic view of Wicca being an ancient Celtic religion is that my first introduction to the ’Old Religion’ was with both a Greek and Roman pantheon. I distinctly remember an argument with a school teacher about the nature of the mythology we were studying. Although the clans wfsfoeusedonGrdekandRy man mvtluilmgy.tdalready been introduced toHindumytholoonby abrmysitterwho,looiongback| O believe may have been invelnadinrhe Gtkkshnn Conscinupnnscmnvemenn tt reemeS
elnararyyaoolrntayattrabolnrnatrnanlttrofrnatrmynaologyre AtnaolgarnakrytneerenerfoylekdronrGtkksrnndroomnnrmynao
bkknrlnntodlykdrnorHlndlrmynaotogyrbyrnrbnbyelnnktreao, bktlkvkrmnyranvkrbkknrlnvotvkdrlnrnakrKtleannrConeylolenkeermovk tkneonnbtkrnorbktlkvkrnannrlfrnakrmynaotogyrofronkrpkoptkrenerlnrfnynrna nakrmynaotogyrofrnnonaktrpkoptkreoltdrbkrnakltrtktlglon.rIrytnlmkd anndrenernnrnnylknnrtktlglon;rakrytnlmkdrlnrenerjlenrenotlkernndrnonrt “WannrnaknrlernakrdlffktknykrbknekknrnakrCatlenlnnrBlbtkrnndrnnyrpntn mynaotogy?”rHlernneektrenernannreannrlerlnrnakrCatlenlnnrBlbtkrtknttyr yotdlngrnoreao?”rIrneskd,roffktlngr“Yolrpktanpe?”rWktt,rnakrnknyak ptlnylpnt’erofflyk.rTaktk,rIrtnnktrkxptnlnkdrnannrIrenerjlenryltlolernboln nknyaktrkxptnlnkdralereldkrofrnakrenoty,rnndrnakrptlnylpntrkxptnlnkdrn it was, it typically noted a leader or elder. Most of the printed material there was to
rfo
ern
lek
172 A Wiccan Bible
now infamous newsletters from New York. I thmA I rememberbieding material by Herman Slater, but to be honest I can not be sure. Published books were hard to come it was, it typically noted a leader or elder. Most of the printed mate read was academic, although there was a bit of Dr. Leo Martello, Syb now infamous newsletters from New York. I think I remember rea Herman Slater, but to be honest I can not be sure. Published books we by and frankly, the majority of what I read was illegally photocopied.
While in the U.S. Military, I received dog tags that said ’No Pr religion. I think it might have been abbreviated. I mentioned this to m and explained that I indeed had a preference. He sent me to the cha me what I believed. I explained my belief system; he looked it up in a and then explained that I was Wiccan. Though I argued the point, th was just a bit too pompous for this simple Pagan, he insisted that it w the military had for my dog tags, so I reluctantly accepted.
When I returned to the United States, I found a group of folk in called the Pagan Community Council of Central Ohio. I attended th talked with them. Although there were a few folk following Native couple following Northern European Pagan paths, the great majori Celtic Wiccans. It seemed everywhere I went the only thing that o percent of Pagans reportedly following a Celtic path was the percent mall goers who wore Don Johnson-style baggy pants. The Celts were of fashion.
when I read that the onciookCeitsuswh to makeooen hutkfollsan parted theiereli-gious celebrationh.Now, I beow tWewonfcoenwns aEuahpeankeomuseWto dne-uil'ic many different gahins and pot theNywWooldhiscovorywtmene (theancnstwroW modi
WtI ahete ao WoateII ahe eveta -otIa httl. The IattW ahta btoke ahe c h^sit. There werwevenarewhiagramsandrvegytSddellyou,iOi(woswrea( lucks that author was taiUtnodbout,it wassomeimnUtw lhegwwhea(tnowcaucien(Cditn wero srly lo--etela \troly rll loa ahe New Wotll loyaovety o- srze (ahe r dtl aotl)t bta ahd rtahot wry trahdt ypdao-oa ahra ahdyd lolly wdtd husks. Thdtd wdtd dvdl r -dw lor\trsy rll n’vd \oa ao adll yott o- oa ahra rtahot wry arlkol\ rbotat oa wry yosd so\hay lrt\d whdra ahoyd rl r \towol\.
nl 1993t n opdldl r er\rl yhop ol Ohoo rll yda rbota ahd aryk yhdlvdy woah booky ahra n ahot\ha wdtd rpploarbld. Ul-otatlradlyt ah hrtl ao -oll rll lol loa ydll wdll. Thd vdlaoa atrzd hrl yda ao lod otat Woaarl wry bdaosol\ sotd rll sotd -ryhoolrbld. To yary ol btyoldy ol\ sy atyaosdty whra ahdy wrladlt rll n boa sy lop ao -o\ha brak a whold oldr ahra Woaar oy rl rlaodla vdlaoa tdlo\ool.
Thdl yosdold rykdl sd ahd qtdyaool ahra ldl ao vhrpadt 9. Th aolltaadl -ot ahra ahrpadt ldl ao ahd -ollowol\ ol-otsraoolt rll n lo arlldl co\ha Srbbray o- ahd Woaarl tdlo\ool rtd raatrlly soldtl aol
The Holidays
Wicca is a world religion. It embraces Srnversal ide as TuchBstOk CfeH^r daiys) Lord and Lady and it embraces specific incarnations of those universal ideas, such as
The Holidays
gam of the holidays celebrated by the many cultures that have led to the union of reli-
Wicca is a world religion. It embraces universal ideas such as th Lord and Lady and it embraces specific incarnations of those univers individual names for our Lord and Lady. As such, its eight major holid gam of the holidays celebrated by the many cultures that have led to t gious observances that we today call the Wheel of the Year.
Unfortunately, even if the ancient cultures on which Wicca is base written records of their traditions and holidays, the past five or six hun seen a level of religious intolerance previously unknown during the m sands of years that humanity has walked this Earth. Some traditions together. Many more have been lost forever. But records of one P have survived much better than others. It language is in use in modern m animal husbandry, and a variety of other sciences. From that Pagan have received the basis for modern government. From that culture Edict of Milan as the basis for the First Amendment to the Constituti States of America. I am of course speaking of the culture formed by Roman and Greek cultures.
In understanding the modern Wiccan Holidays, we do well to exa Pagan holidays. In examining the ancient Pagan holidays, we do we their holidays were recorded well enough that they survived the te
Winter Solstice

The Greek Wheel of the Year
Approximated Gregorian dates are provided; however, these dates would only be
174 A Wiccan Bible
date of June 22n1and then if each following new AoonfcllaltBrnating 28 and 29 days after each other. Of course the lunar cycle does not alternate neatly to fit into the solar Approximated Gregorian dates are provided; however, these dat valid if the first New moon after the Summer Solstice were to fall o date of June 22nd and then if each following new moon fell alternatin after each other. Of course the lunar cycle does not alternate neatly to year, so the given dates are not to be considered accurate. They are pr that the reader can receive a sense of where in the year these celebra
It is also important to note that as of about the 6th century before Greek year began on the first new moon after the Summer Solstice. T that followed keyed its start on the next new moon. Because 12 lunar neatly into a solar year, the month of Poseideon was repeated. To pres relation to the modern concept of the year, instead of presenting it her the traditional first month Hekatombaion (which begins shortly after S
Greek Holidays
Gamelion actually begins on die sevendi new moon after Summer Solstice This is die preferred mondi of handfasting in Greek traditions
Gamelion 1 |
Noumenia-Celebration of the new moon. |
Game lion 2 |
This is the preferred month of handfasting in Greek traditio |
Game lion 3 |
Sacred to the Three Graces and Athena. |
Game lion 4 |
Gamelion 1 Noumenia—Celebration of the new moon. |
Game lion 6 |
Gli 2 Sd t Ath Di |
Game lion 7 |
Gamelion 3 Sacred to the Three Graces and Athena. |
Game lion 8 |
Gamelion 4 Sacred to Aphrodite Hermes Hercules Eros. |
Game lion 9 |
Gamelion 6 Sacred to Artemis. |
Game lion 14 |
Gamelion 7 Sacred to Apollo. |
Gamelion 27 |
Sacrifices offered to Poseidon and Demeter. Gamelion 8 Sacred to Poseidon. Sacrifices offered to Apollo and Gamelion 9 Sacrifices offered to Athena. couple. Although there are numerous cites to this couple having wild Gamelion 14 Lenaia—Festival to honor Dionysus on the day of the Gamelion 27 Sacrifices offered to Poseidon and Demeter. |
Gamelion 28 |
Gamelia/Theogamia—Festival to honor Zeus and |
Gamelion 29 |
couple. Although there are numerous cites to this c |
Gamelion 30 |
fargtuimelnts (especially over infidelity), their marriage w Gamelion 28 Sacred to all Chthonian (Underworld) deities |
Liber ab Solemnitas (The Book of Holida
Anthesterion actually begins on the eighth new moon after Summer Solstice.
Anthesterion 1
Anthesterion 2
Anthesterion 3
Anthesterion 4
A
Anthesterion 5
A
Anthesterion 6
A
Anthesterion 7
A
Anthesterion 8
A
Anthesterion 11-13
Anthesterion 14
Anthesterion 23
Anthesterion 27
Anthesterion 28
Anthesterion 29
nthesterion—February—Approximation January 26—
Sacred to Agathos Daimon. Sacrifices made to Dionysus.
Anthesterion actually begins on the eighth new moon after Summe Sacred to the Three Graces and Athena.
hesterion 1 Noumenia—Celebration of the new moon.
hesterion 2 Sacred to Agathos Daimon. Sacrifices made to Diony
hesterion 3 Sacred to the Three Graces and Athena.
hesterion 4 Sacred to Aphrodite, Hermes, Hercules, Eros.
Sacred to Poseidon.
hesterion 5 Soteria—Festival honoring Zeus.
hesterion 6 Sacred to Artemis.
Reflects greatly on the three stages of life, which Wiccans know in the hesterion 7 Sacred to Apollo.
hesterion 8 Sacred to Poseidon.
Dayoon iscalled Pithoiges,whichmeans’fcemSheaar’ or’jarogeDiag.’
Reflects greatly on the three stages of life, which Wi meminine aa Maiden, Mother, and Crone and in Maater, Father, and Sage.
Da’ one ia called Pithoigia which meana ’mrom the ja On thia da’ the bottlea om new wine are opened and intoxication ia generall’ mrowned upon. Thia da’ ia mo shared in great revwioeaodaccompanie d wi thfeasti mg, games, rndritu-era are given to the children who were born during the cauldron’ or ’Pam thegehtles.’ Onthrsday,cauldronrweregned
maanar’m,omrtaarcup.’rOnrtaiaroa’rtaarpinaraaiactaort dead. With the assis-anceor Hermes, ’he OeadacecoiledPovisl-tdo living.
taa yalio,on’ o, ’m,oh taa kattiaa.’ On taia oae, yal
Diasia—Festival hnnorino Zauc,whicltishnleawayfrom ora city in soma oa-o. Wita taa -aaiat-oya om oaacaa, taa oa-o -aa ,ieior.
dataing, and ahanF Uo callon Zeur tcat^ela>trelcomeandregorm tasmg.
Satsadtoall Chthonian heities>
aa,-tiea,e aay,loao -aa-. Gaa-t ma-atior taai a,-ya ni has-oa ta tas ni,o (ay-ttsaso iota tas naaoa). Io tas
176 A Wiccan Bible
Elaphebolion actually begins on the ninth new moon after Summer Solstice
Elaphebolion 1
Elaphebolion 2
Elaphebolion 3
Elaphebolion 4
Elaphebolion 6
Elaphebolion 7
Elaphebolion 8
Elaphebolion 9-14
Elaphebolion 14
Elaphebolion 15
Elaphebolion 28
Elaphebolion 29
Elaphebolion 30
Elaphebolion—March—Approximation February 24—
Sacred to Agathos Daimon.
Elaphebolion actually begins on the ninth new moon after Summe
Sacred to the Three Graces and Athena.
hebolion 1 Noumenia—Celebration of the new moon.
hebolion 2 Sacred to Agathos Daimon.
and sesame seeds are made in the shape of Deer (stag) and scattered in
hebolion 3 Sacred to the Three Graces and Athena.
hebolion 4 Sacred to Aphrodite, Hermes, Hercules, Eros.
hebolion 6 Elaphebolia—Festival to honor Artemis. Sweet bread
and sesame seeds are made in the shape of Deer (stag wooded areas. Although this day celebrates Artemis cceheeryraweere wconducetead susninegncdeeerropmopmpeeats..nsea,c
hebolion 7 Sacred to Apollo.
and sexual, with public celebration, sacred theatre, and a procession hebolion 8 Sacred to Poseidon.
Asklepia—Festival in honor of Asklepios.
haboxio—Festiva 1 tohonor Rhea. a—efettivaltokeohs nDmefromthe and sexual, with public celebration, sacred theatre, laadteg to tha crowteg of a phalltc rymbol, rymboltc o
hacreaonngthe am ountof molk —ndinkressingSheamounthf honey.Thoso swcotawere give n tochildre—inceieb rotimoofthRirgelatianehipio Rhea i
noodlhilixti.lStmtlinltolhotloitmaillailixtiltrlcinl mtlkliedlrwaataeadlwttilioeay.lCiedylwirlmidalte dacnairtealtialimooetlonlmtlkliedltecnairtealtialimoo rwaarwanaavaeocnaeecaanioeoanna ielEintildotian,liedltialcommoettylttraln.
ictl28 SdltllCititldttt
Mounichion—April—March 26—April 23
Mounichion actually begins on tire 1 Oth new moon after Summer Solstice
Mounichion 1
Mounichion 2
Mounichion 3
Mounichion—April—
Mounichion actually begins on the 10 Sacred to the Three Graces and Athena.
Mounichion 4 |
Sacred to Aphrodite, Hermes, Hercules, Eros. Liber ab Solemnitas (The Book of Holidays) new love. |
Mounichion 6 M |
Sacred to Artemis. ounichion 4 Sacred to Aphrodite, Hermes, Hercules, Eros. Eroteia—Festival in honor of Eros. This day celebrat new love. |
M Mounichion 8 Mounichion 13-14 Mounichion 14 M Mounichion 16 M M M M |
ounichion 6 Sacred to Artemis. Delphinia—Festival to honor Apollo. Virgin girls br sowneseaferteraavselatnhrocaugehsouot thsespernndei.ng Seurmnmgsera.npr ounichion 7 Sacred to Apollo. ounichion 8 Sacred to Poseidon. rising of the moon and ends with the setting of the moon. In part, this nasa celebration oDfemare aouthandbeauty(teenaeemet.Traditionally, nkaclap girls wouId danceand olaygkmestetoughthe mghi.Today such paacticeeare taintedwith thotexual undeagoneofnedity, et euch practices are not crnducieU wete aanyouOh.Evewifoneispureogheaet, such practices are Wostnae eogduateg urieospartiuiponmgeoetiagereaoe skyal.o gagls waulo o.nae .no pl.y g.ees tcgaugc tce pg.ataaes .ge t.anteo watc tce sexi.l inoegtane a pg.ataaes .ge nat aanoiateo watc aig aaitci Ehen au an |
Mounichion 17 |
siac pg.ataaes .ge oest nat aanoiateo inless p.gtaaap. an tce agoeg au e8 .no e9 ae.gs au .ee uag aohaais oea.ise wcale aai e.a oe pige .t ce.gt aai a.nnat sp au .na oit aaigselui |
Mounichion 19 Mounichion 20 Mounichion 27 Mounichion 28 M Mounichion 29 M |
ainaacaan e7 BltbldneitoA aantani.taan au tce uestah.l canagane pgehaais o.ai ycas o.a aeleog.tes aaineeg eagls gpge-aAngattae.etaaasni gate, oit .n antgaoiataan au aaine eagls ta aig ainaacaan e9 Olumpeitotestah.l an canag au Zeisi ainaacaan 20 S.agauaaes auuegeo ta Leiaappei |
Thargelion—May—April 24—May 23 |
|
Thargelion |
actually begins on tire eleventh new moon after Summer Solstice |
Thargelien Thargelien 2 Thargelien 3 y |
Thargelion—May—April 24—May 23 Sacred to Agathos Daimon. Thargelion actually begins on the eleventh new moon after Summ Sacred to the Three Graces and Athena. c.geelaan NdumenitoCeleog.taan au tce new eaani to Apollo, Hermes, Leto, and Zeus. |
Thargelion 6-7 1 T |
Thargelia—Festival to celebrate the birthday of Artemis (day 6) and 78 78 A Wiccan Bible preparations for a festival were thought a part of the festival itself, as oepose6t7 the m oremgeem aFesovahtocelebration whereoneor teeo people prepare evepOhiog forguetts.Onthe seconddayAhe breads made the previousOay were daarficed(seattereOto fhd woods)in the hopes that the offsring wihleeingrertiHty th tbe land.Inanaisnitimes, oppoeef to the aore aofere approach to celebratioe people prepare everdtdien ior nIeete. se tde eecoe aafe tde previoIe fad bere eacriiicef (ecatteref to dopee tdat tde oiierien bill brien iertilitd to tde laef. tbo criaieale bdo daf beee eeeteecef to featd bere |
Thargelion 7 |
fad. Later, tded bere excoaaIeicatef. Tofad be cae a tiae bdee tdoee bdo dave broenef Ie are baeiede Tde ieetival biefe fobe bitd a proceeeioe to doeor He |
Thargelion 8 T Thargelion 15—19 T |
(Mooe), aef tde Horae (Seaeoee). darnelioe 7 se tdie fad, cdilfree bdo daf beee afoptef bere r Bendideia—Festivpr Isosnribg veemerarstrngoddeth Benei. Ceuihe0 one of the festivals of which are referred to mAradia Gospel of Witches darnelioet8 SacrefttotPoeeifoe. |
T T |
darnelioet15 FIlltMooetcelebratioee. darnelioet15a19 BendideiaaFeetivaltdoeorienttdetTdraciaetnoffeeet oeetoittdetieetivaletoitbdicdtaretreierrefttotietAradia aet’tdetnaaetoitBeeeveeto.’ |
Thargelion 25 |
darnelioet16 SacriiiceetaretoiierefttotZeIe. darnelioet22 KallynteriaaTdetcleaeientoittdetteapletoitetdeea,tb celebrateftaetSprientcleaeientoittdetdoaetaefteepecia |
Thargelion 28 Thargelion 29 Thargelion 30 |
ietaoferetWicca. darnelioet25 PlynteriaaFeetivalttdattieclIfeettdetcleaeeientoittdett bceeoaeaeeceeraeaeprenceaeen eepeciallyttdetaltartrooatietaoferetWicca. |
Skirophorion—June—May 24—June 21 |
Skirophorion actually begins on the 12th new moon after Summer Solstice The entire month is sacred to Athena.
Skirophorion 1 Skirophorion 2 Skirophorion 3 |
Noumenia—Celebration of the new moon. Skirophorion actually begins on the 12th new moon after Summe Sacred to Agathos Daimon. The entire month is sacred to Athena. Sacred to the Three Graces and Athena. Sacrifices offered to Athena, Aglaurus, Poseidon, and Zeus. |
Skirophorion 4
Skirophorion 6
Skirophorion 7
Skirophorion 8
Skirophorion 12
Skirophorion 14
Skirophorion 22
Skirophorion 27
Skirophorion 28
Skirophorion 29
Arrephoria—An alternative day often cited. See Skirophorion 22 for details.
Liber ab Solemnitas (The Book of Holidays Sacred to Aphrodite, Hermes, Hercules, Eros.
Sacred to Artemis.
Arrephoria—An alternative day often cited. See Sk details
Sacred to Poseidon.
ophorion 4 Sacred to Aphrodite, Hermes, Hercules, Eros.
ophorion 6 Sacred to Artemis.
Poseidon. Although there is no hard rule, speaking in general historic ophorion 7 Sacred to Apollo.
ophorion 8 Sacred to Poseidon.
ophorion 12 Skirophoria—Festival in honor of Athena Demeter
Poseidon. Although there is no hard rule speaking i terms Skirophoria was celebrated only by women. To is participated in by both men and women. Great offe Arrephoria— cakes and baked goods shaped like snakes and the m
offerings are placed in hidden places where animals They are later retrieved at Thesmophoria for use as f
ophorion 14 Full Moon.
ophorion 22 Arrephoria—Festival honoring Athena. In day of ol
(ages 7 to 11) were elected on this day and then placed Pyanepsion (Gregorian approximation October 17t virgin’s placed in the cave the previous Pyanepsion a the cave. Modern Wiccans do not hide their children months. Or do we? Certainly in Northern climates t time between October 17th (their entrance to the ca (their release) we do spend cooped up in our home weather. Perhaps this holiday can be honored by el girls from our community each year who will promi Winter planning and preparing for the Arrephoria celebration of Winter’s release of Summer.
Arrephoria is sometimes cited on the third day of Ski
Hekatombaion 2
Hekatombaion 3
Hodhoolonibaioii—JkM—|шіе22—Jii.ly2.1
Hekatombaion actually begins on tire first new moon after Summer Solstice Sacred to Apollo
Hekatombaion—July—June 22—Jul
Hekatombaion 1 Noumenia—Celebration of the new moon.
Hekatombaion actually begins on the first new moon after
Eiseteria—Festival which honors Athena and Zeus.
Sacred to Apollo
Sacred to Agathos Daimon.
Sacred to the Three Graces and Athena.
Hekatombaion 4 1 H |
Aphrodisia—Bathing festival of Aphrodite and her daughter Peitho. Celebrated with the ritualistic bathing of statuary as well as feasting, 80 A Wiccan Bible and sex. The fourth day of Hekatombaion is also sacred to Hermes, ekatombaion 4 Aphrodisia—Bathing festival of Aphrodite and her |
Hekatombaion 6 Hekatombaion 7 Hekatombaion 8 Hekatombaion 12 H H |
Celebrated with the ritualistic bathing of statuary a dancing, and athletic games. This was also a celebration and sex. The fourth day of Hekatombaion is also s Sacred to Poseidon. Hercules, and Eros. ekatombaion 6 Sacred to Artemis. ekatombaion 7 Sacred to Apollo. |
Full Moon celebration. |
Hkbi 12 Sifi d Ai
Hekatombaion 27 H H |
. Kronia—Harvest celebration in honor of Cronos. eaomaon u oon ceeraon. boymaaogiilsiouIddance andcompetemtorchlhfootuaces.Honomo Adonis. Also sacred totheCbthoiuan cl^^tfes. |
H |
SacmedtoallChthsmandehier. |
H Hekatombaion 30 |
Lesser Panathenaia—(nelebrationo^thenatsbirthday.ThaPanatheoaiy was celebrated annuollyasa (MiedaylioHdayCLesscr/Minon eaaathenala). oloa.a. orao aaiail eo eni Cnenoa.aa li.e.ia. ikaeomua.oa l9 Saiail eo arr Cnenoa.aa li.e.ia. Lerrer aeCetheCeceaCiriuaae.oa od oeniaa’a u.aenlal aaa iiriuaaeil aaanarrl aa a oai lal nor.lal (Liaaia/M. Saia.d.iia aiai mali eo oeniaa, Hlgi.a, aal N.ki. |
Metageitnion—August—July 22—August 19
Metageitnion actually begins on the second new moon after Summer Solstice
Metageitnion 1 Metageitnion 2 Metageitnion 3 M M M M M M |
Metageitnion—August—July 22—August 19 Sacred to Agathos Daimon. Metageitnion actually begins on the second new moon after Summ Sacred to the Three Graces and Athena. ieagi.ea.oa i NoumeCceaCiriuaae.oa od eni aia mooa. Sacred to Artemis. ieagi.ea.oa l Saiail eo ogaenoa Da.moa. ieagi.ea.oa 3 Saiail eo eni onaii Gaaiia aal oeniaa. Sacred to Poseidon. ieagi.ea.oa 4 Saiail eo opnaol.ei, Hiamia, Hiainria, Eaoa. Sacred to Hercules. ieagi.ea.oa o Saiail eo oaeim.a. ieagi.ea.oa 7 MetegectCceaFiae.var noaoa.ag oporro an.in iiriua children. |
Metageitnion 15 Metageitnion 15-18 Me |
Full Moon—Celebration marks the beginning of the Eleusinia. Liber ab Solemnitas (The Book of Holidays) associated with the school of mysteries, but instead shares its name because this festival started in the city Eleusis (as did the mystery school). tageitnion 15 Full Moon—Celebration marks the beginning of the |
Me Metageitnion 20 Metageitnion 25 Me Me Me |
Sacrifioesm-de to Heusin an-Artemo Sacrifices made to Hera. be Sacrifices made to Zeus. ^giiitedto all Chthseim (Undereorid)Deitiee. ^giiitedto all Chthsnirn (Undeaeorld)Deities. DarkPOeon^SacredioHesadmandollCUthonian (Underworld) Deities. |
Boedromion—September—August 20—September 18
Boedromion actually begins on die diird new moon after Summer Solstice
Boedromion 1 Boedromion 2 |
Boedromion—September—August 20—Septemb Boedromion actually begins on the third new moon after Summe Niketeria—Festival to honor Nike. |
Boedromion 3 Bo Boedromion 4 Boedromion 5 Bo Bo |
Sacred to the Three Graces and Athena. earodioeld Noumenia—Celebretioelonltheleewldooei earodioel2 eeirealtolAgethoslDeidoei Niketeria—FestivelltolhoeorlNikei to Agathos Daimon. Offerings of flowers, rice pudding, honey, and earodioel3 eeirealtolthelThreelGreiesleealAtheeei earodioel4 eeirealtolAphroaite,l)erdes,l)eriules,lErosi |
Bo |
earodioel5 Genesia—Festivellhoeorieglaeealeeiestorsletlwhiihlo tolAgethoslDeidoeilOnneriegslonlnlowers,lriielpua butterlereldeaeltolAgethoslDeidoeilOnneriegslonl |
Boedromion 7 Bo |
aisheslereldeaeltolthelaeeailGintslerelexiheegealbet aaviorfrom war. Onmis AgrwehKhar poliae оіЄісєіп. docOors, uiiil es huetressi Codpetitioes on erihery ere ontee nollo |
Boedromion 8 Bo Bo Bo |
ieiluaie, duih deeti earodioe 7 Boodromia—Festivel hoeorie, Apollo ie his iepeiity sevior nrod weri Oe this aey we hoeor poliie onnii others who proteit our ioddueityi earodioe e eeirea to Poseiaoei earodioe d2 Domocratia—Festivel ie hoeor on aedoireiyi Alth marriages. But on escaleonesizeona moderoneiion,herrisclraapruon eea leter idprovea upoe by the Rodees it seeds e ,r Pe,ees weet to eaort soiielisd es e eetioeel rolii |
Boedromion 14 1 B |
Eleusian Mysteries—The Full Moon of this month marked the festival of the Eleusinian Mysteries. Held as a one day festival annually but 82 A Wiccan Bible Demeter and Persephone and were the most sacred of all the Greek oedromion 14 Eleusian Mysteries—The Full Moon of this month m |
Boedromion 16 Boedromion 27 |
of the Eleusinian Mysteries. Held as a one day fes expanded to nine days every fifth year. The Eleusinia Demeter and Persephone and were the most sacred |
Boedromion 28 Boedromion 29 Boedromion 30 |
esvas. oedromion 16 Epidauria—Festival in honor of Asklepios. oedromion 27 NSacrifihces are made to the Achelous, Athena, Gaia, |
Pyanepsion—October—September 19—October 17
Pyanepsion actual begins on die fourdi new moon after Summer Solstice
Pyanepsion 1 Pyanepsion 2 Pyanepsion 3 P Pyanepsion 5 |
Pyanepsion—October—September 19—October Sacred to Agathos Daimon. Pyanepsion actual begins on the fourth new moon after Summer Sacred to the Three Graces and Athena. yanepsion 1 Noumenia—Celebration of the new moon. yanepsion 2 Sacred to Agathos Daimon. the tending of farmland. |
P P Pyanepsion 7 P |
yanepsion 3 Sacred to the Three Graces and Athena. Sacred to Artemis. yanepsion 4 Sacred to Aphrodite, Hermes, Hercules, Eros. yanepsion 5 Proerosiea—Festival honoring Demeter and Persepho the tending of farmland. |
P P P |
yanepsion 6 Sacred to Artemis. yanepsion 7 Pyanepsia/Puanepsia—Festival honoring Apollo, Horae. Offerings of fruit were made in hope that b granted. yanepsion 8 Oskhophoria—Festival in honor of Dionysus and Aria as women symbolizing the feminine side of masculi men. Women carrying a sacrifice of a grand dinn cross-dressed men to the ocean where the food was t to Poseidon. Athletic games and general revelry follo lovemaking by couples in their homes and groups in pu day is sacred to romantically involved couples as it cel of Dionysus with Ariadne. |
Pyanepsion 9 |
Theseia—A festival apart from Oskhophoria, which i At Theseia, a procession of children would participa mal games to honor Theseus (King of Athens). A f |
Persephone. Participation was only allowed after eight days of abstinence from sex with men prior to the holiday. The Stenia was the opening celebration oL theThesmophoriminwhsch Theenjokinglytaunted each other and symbolically whipped each other with branches, working themselves into frenzied ecstatic dances.
Pyanepsion 9-14
Pyanepsion 14
Pyanepsion 27
Pyanepsion 28
Pyanepsion 29
from sex with men prior to the holiday. The Stenia celebration of the Thesmophoria in which women jok other and symbolically whipped each other with b themselves into frenzied ecstatic dances.
epyiori9—to the feTtivaS. OpthrsecoFddvaofThenmrphoDie, teewomec in by women only. Although one did not need to be anyehfng excepe ehe openfng rfees (Seenfa) ten were To parefcfpaee woten had eo be abseafn hrot sex w ting food that remains hr eheOemple trom One previounofferOigsat the shared cottunal baehs fn ehe sea. A todern fneerp swfttfng fn lecfl penas er even spfrfng f pee eub. Ohh perk fre tfae hefses eh brefa fna bfkea geeas fre ex efng heea epfe retffns fn epe eetple hret epe prevfe
Full Moon celebration.
especfflly bfnley. Dunfng epe spestepp fna afa nee bnusp epefn pffn en faenn less. On epe hfnfl afy, epey neeunn pete
epsfen to Full Moon celebnfefen.
Dark Moon—Sacred to Hecate and all Chthonian deities.
Maimakterion—November—October 18—November 16
Maimakterion actually begins on tine fifth new moon after Summer Solstice
Maimakterion 1
Maimakterion—November—
Maimakterion 2 Sacred to Agathos Daimon.
Maimakterion 3 Sacred to the Three Graces and Athena.
Maimakterion 4
Maimakterion 6
Maimakterion 7
Maimakterion 8
Maimakterion 14
Maimakterion 20
tfkeenfen t Nou.eniacCelebnfefen eh epe new teen.
Sacred to Artemis.
tfkeenfen 2 Sfcnea ee Agfepes Dfften.
tfkeenfen 3 Sfcnea ee epe spnee Gnfces fna Aepenf.
Sacred to Poseidon.
tfkeenfen o Sfcnea ee Appneafee, Hentes, Hencules, Enes.
tfkeenfen 6 Sfcnea ee Aneetfs.
tfkeenfen 7 Sfcnea ee Apelle.
Men wore women s clothing and pretended to be the Horae. Both men tfkeenfen 8 Sfcnea ee Pesefaen.
tfkeenfen to Po.paiacFesefvfl ee penen Zeus efkes plfce en epe af
tfkeenfen 20 Mai.akteria Fesefvfl penenfng Zeus fna fskfng pft
Maimakterion 28
Sacred to all Chthonian deities.
Maimakterion 29 Sacred to all Chthonian deities.
Maimakterion 30 Dark Moon—Sacred to Hecate and all Chthonian deities.
Poseideon (greater)—December—November 17—December 15
Poseideon actually begins on die sixdi new moon after Summer Solstice
Poseideon 1 Poseideon 2 Poseideon 3 Poseideon 4 Poseideon 5 Poseideon 6 Poseideon 7 Poseideon 8 Poseideon 14 |
Poseideon (greater)—December—November 17—Dec Poseideon actually begins on the sixth new moon after Summer Sacred to the Three Graces and Athena. Poseideon 1 Noumenia—Celebration of the new moon. Plerosia—Festival in honor of Zeus. Poseideon 2 Sacred to Agathos Daimon. Poseideon 3 Sacred to the Three Graces and Athena. Poseideon 4 Sacred to Aphrodite, Hermes, Hercules, Eros. Poseideon 5 Plerosia—Festival in honor of Zeus. Poseideon 6 Sacred to Artemis. men with large wood phallus images symbolic of masculine fertility. They Poseideon 7 Sacred to Apollo. Poseideon 8 Poseidea—Festival honoring Poseidon. Poseideon 14 Lesser Dionysia—Festival honoring Dionysus. A pr |
Poseideon 16 Poseideon 26 |
men with large wood phallus images symbolic of mascu are followed by women carrying baskets (symbolic o with the feast preparations. After the feast was a m Full moon celebration. Poseideon 16 Sacred to Zeus. Poseideon 26 Haloa—Festival honoring Demeter Dionysus Poseido A procession with food and offerings followed by a fea |
Poseideon 27 Poseideon 28 Poseideon 29 |
for the feast to contain breads and cakes shaped like re At the traditional Greek celebration, the evenings e e orer o sy ca women aunng eac oer w and insults designed to stir the lust in their male audi Poseideon 27 Sacred to all Chthonian deities. |
Liber ab Solemnitas (The Book of Holidays)
The lesser month of Poseideon is a short month, perhaps not a month at all, with approximately 10 days. It was used for die purpose of rectifying die
Poseideon (lesser)—December Continues—Decemb
The lesser month of Poseideon is a short month, perhaps not a m ppdiscrepanycy betwyee.n the solar year andplunpar months.
Poosseeideeoonn 10 Heesrsaecrleias—ceFpeestaiv—al heosnovraingoHnoerrcnugles.sCoeupldosl,astptoh
Please note that the ancient Roman year started with March; however, I have arranged the year here starting in January for easier reference. In fact, depending on
The Ancient Roman Calendar
dar started in January, the change being made by Gaius Julius Caesar to align better Please note that the ancient Roman year started with March; ho
ranged the year here starting in January for easier reference. In fac how one wants to use the word ancient we can also state that the ancie dar started in January, the change being made by Gaius Julius Caesa with the solar year. The Roman calendar does not use the simple nu that we use today. Instead, it addressed the problem of lunar months n soar year y orerng te monts o eac ay to te Caens, Nones
monthm.Sacred to Jupiter.
Nones: The seventh day of March, May, July and October, but the fifth day of all Caleads: The aew mooa marks the first day of the moath.
Ides: The 15th day of March, May, July, or October aad the 13th
Noes: Tmhoeatshesv.eSathcreddaytoofJuMpaitrecrh., May, July ad October, but th
Roman Holidays
Januarius 1 Anno Novo—Sacred to Janus and Asklepios.
Januarius—January—Sacred to the god Janu one looking forward to the future and one looking backwards to the past. It is a day of both reflection and planning. Ovidius asked of Janus, Januarius 1 Anno Novo—Sacred to Janus and Asklepios.
This day is sacred to Janus who is often depicted as one looking forward to the future and one looking past. It is a day of both reflection and planning. Ovidi “Why do we now celebrate the New Year in the m
Januarius 3, 4, or 5 18 Ja |
The Campitalia—Celebration of extended community. The celebration of Lares (of the crossroads) is a celebration of the countryside that takes 6 A Wiccan Bible munity unity, a chance to reach out, greet, and exchange goods with your ariudborine efflagee.ercahOonally — hae taranplacebeewden Demember nth and January 5ehbutismostoften recordedonJenuaroS, 4, oe 5. |
Januarius 5 Januarius 8 Januarius 9 Ja Ja |
place at the mergilg of roads betweel villages. This is Sacred to the goddesnJustilia. neigtneringtviJJagei.tTraditienaJJytitttaittakentpJafetn Agonaha of Januaeiut-tdonorsar Sarnes. Thsnameof ЛЫюТПау fiecSv its root in the word agonium, meaning ’sacrificial rites. This is one of four festivals by the same name December Irtzu. honors Sol, Маг5ІіІ711і honorsMassJnnd May 21th honors Veiovis. |
Ja Januarius 11-15 Ja Ja |
luariuis9 Agonalia of Januarius—HelerilgsJalui. Tteslamese4satiisteJida.s4ildisiaisreeasilsateswerdsagon r11antsaterleeriisoeJsMi airnetlse17eatsteeulrereiisMvaariisa.ldsMe ai.asm21 holiday is similar to the modern cultural New Year s eve in that we re-luariuis11 Juturnalia—Asda.saestelersatesgeddeiisJuaurla. aealsoloak to thcfutureana coneiderretolulioes hopimythat those Ttes4enuise4satiis4eiaivaJsiiselsdivilaaielsaldsre4Jenaie |
Januarius 13 Januarius 16 Januarius 17 Januarius 24 Ja Ja |
teJida.siisiimiJarsaesatesmederesnuJauraJsNewsYear’is 4Jenaseesatespaiasaedsieeksaes4iedsnJeiureseesiiiueiswia rweeieaJuiaeieeeieswiJeJsntaeesuesuatrees4aueaurneesweiesaerresrneuirereueaJe.estie ТГіп SOmentivae-^fedis—FS_JsiMn^gOTa^aydsae_oSsaetls honoring Tellus Mater and Ceres. With the invention of modern machine farm-eSariSi o6 o da. ae teeer ate seddeii heenerdiaa eSariSi o7 o da. ae teeer ate seddeii FeJiniaaia rvetithe concep t behinSsowingaee—s eeelyisrtillvnliW.ThirisarlmeSo TeJJuisMaaersaedshereiasWiatsatesieveeaieese4smede haps a time to reseercTtdat bsdeyoyhevsbeenthmlmaasboutwritiae. It is also a time of saerifiee. Traditione’ly, eekesanhpork wsro ofiared to Tellus on this (куТоОаусГ^тп^Лі neluesfe dayermeal do joar charity or maybe non-ptrithable aoik uroducSseoyout Seed feademeL ter. As you do, remembermhe feletioofOSpaf TeHusanO Oesee.Ceres provides the grain andTeUas e^eitr plane to atow.lT sacrifken,you assume the role of CeresgSdSee oousgrain1waskproducttSoTeПustcm4r-ntarias er masse eee-keriitasJe kerk kredSnai ae se |
Januarius 27 Januarius 30 |
aera oi seS de, rememser ate reJaaieeitik e4 reJJSi kresidei ate sraie aed reJJSi sisei ia a kJane ae sree aiiSme ate reJe e4 herei sisies seSr sraie (eerk kredS |
Liber ab Solemnitas (The Book of Holid
Februarius 1 and 2 Februarius 2 Februarius 5 Februarius 5-7 Feb Feb Feb Feb |
Festival day of the Juno. Februarius—February—Sacred to the god Mars and go Festival day marking the beginning of Spring. ruarius 1 and 2 Festival day of the Juno. The feast moved about on the calendar from about the fifth of the month ruarius 2 Sacred to Ceres. ruarius 5 Festival day marking the beginning of Spring. Quirihaliatomakehe for Па |
Februarius 9 Februarius 12 Februarius 13-21 Feb Feb Feb |
Sacred to Apollo. Sacred to Diana. The Parentalia—Honoring A.,1 m, especially deadcarentu. Thisho^ is thefirdidf-SrreeinFebruarius that seeks to honor and sometimes appease the dead. In the case of this holiday, the focus was eh ieviig honors, paaiac, anDsacrifice to departed parents and family mernb егз. 2'11 at ceremonywaslra—tioncCyCgdahaVesasSVirgmiChl- Thsh hcis,hy sh lha fsihl cf lhiaa sc Fabiehiseh lhhl ha hcealseah hssahha lha ,ah,. Ic lha chha cf lhsh hcis cc gsvscg hcccih sihsha hc, hhcisfsca lc ,ashila, s eaebaih. Thhl caiaeccy whh lih,slscchiiy ia, by h V abihla, wslh lha fhesiy lih,slscch sccie,a vshslscg gih scg saihcchi hhcisfsca lc lha ,ashila, saihhsh siash |
Februarius 14 |
,shh hc, iahvscg sl cc lha gihva hsla cc whsch hcsehi fsihl ,hy bascg h sisvhla saihcchi iafiaclscc wslh lha it is not hard to secwheralhn iVeaoi Vahantine’sCsy SinWs hrPagan kccwscgithhtithayitcciwsiiiccai,hyishit. |
Feb |
TheLur>rrcalia—Honoring JapercuT(reeFauncri, coccaclsociloiioaaihc,iyaiihociVhis’hi,ahcisslsocihhih iliihiccliyhi,ilcihaaiwyaiailyaii,ahicfiVhiaclica’hi, icclh. |
Feb Feb |
TheQuirrnnlla—TheFeapOofFa—s honoringQusrinu^ Ocilyshi,hF,ihcsehihihiaihhs,ilcibafisac,iyeehcslFihc lhccaisciiahciascgisicbiaeh.iIichcilysckicficciballai caiabihlaibclyikslyihclikscifhesishih. eircle, alarge coin riiiiQ'r>iiPiiiy—iyaiO'hyiCleocoihiycnCisn. |
Februarius 18 Februarius 21 Feb Feb |
TyshiycislhFicaiabihlalilyaiihigaiicceeTnslF.ipycTil eshh lyasi icchi Fcichchish, lyaF wceil ehka hhcisfsca iysh laecchlihlah lya sisccssia cf cceeecslF bascg case of this holidac, rha focuswaannunsmguonesa^seise, anh sacri-iehiseh г8 phcial lc Dah ihcslh (h lhF cf hsiacca). Thners 1ith, this holidaywas dhlC mocg toappeasewayviarhshiriis that were often thoabhinoi aПrhhaaondofsn•anrers -usi. Onihlsdah |
we recognize that those who do not have kith or kin often do not for a reason. These forces are linked to the outsiders of Wiccan ritual, those 188 A Wiccan Bible |
|
Februarius 22 |
The Charistia/Carista—Honoring the goddess Concordia. we recognize that those who do not have kith or kin reason. These forces are linked to the outsiders of W who are not befriended as either kith or kin. Februarius 22 The Charistia/Carista—Honoring the goddess Conco This is the Feast of Favor or the Feast of Good Wi with a grand feast at which differences between kith a in a manner of compromise such that all participating the outcome. This holiday is also the third of three i |
Februarius 23 |
seek to honor and sometimes appease the dead. In th day, the focus was on giving honors, praise, and sac friends. Note: Some cites place this holiday earlier in t it the second of three. Februarius 23 The Terminalia—Honoring Terminus. This is a Feast ebrating the old saying “Good fences make good neig |
Februarius 24 |
to celebrate the marking of boundaries both physical is a day one might want to spend with a lifetime frien have become a lover if circumstances had been differe your friendship has flourished because of the clear bo Februarius 24 The Regifugium—Honoring the principles of freedo ebration of the founding of the republic of Rome an the last King of Rome. This is a day of national prid ancient Romans but also to the citizens of all curre |
Februarius 27 |
embrace a democratic system. Its celebration as a relig onstrates the principle that religion and real life con ernment have not always been separate and reflecting a democratic republic. Februarius 27 The Equirria—In honor of Mars. A day of horse ra |
pvuw. |
|
Martius 1 |
The Matronalia—Honoring the goddess Juno and god Mars (her son). MtiMhSd t th d M Martius—March—Sacred to the god Mars children, and now to a day in which any female lover (wife, girlfriend, or Martius 1 The Matronalia—Honoring the goddess Juno and go This holiday began as a day in which mothers were partners. However it grew to include wives who had children and now to a day in which any female lover ( not) is honored Gifts were given to wives and girlfri |
Martius 1
Martius 6
Martius 7
Martius 14
Martius 15*
Martius 15-29
Martius 16 and 17
Martius 17
Sacred to Vesta. Her fires are rekindled by the Vestal Virgins on this day.
Liber ab Solemnitas (The Book of Holidays)
Festival day of Juno.
tius 1 Sacred to Vesta. Her fires are rekindled by the Vestal
tius 6 Festival day of household gods and goddesses.
revelry in an order which many might view as excessive. One of the chal-tius 7 Festival day of Juno.
tius 14 The Equirria—In honor of Mars. Also celebrated on
tius 15* Festival of Anna Perenna—On this day there was sin
revelry in an order which many might view as excessive lenges was to drink as many glasses of wine as one ho sacrifice and prayer were incorporated in what many festive night of the Roman year.
* The Festival of Anna Perenna is actually held on Martius but it is listed here on the 15th for simplicity.
vive15-2o this dayFeiddenfromthegenerulpubhc.
tius 16 and 17 The Bacchanalia —This holiday celebrating Bacchus debt weth eti ebtuxeceted urgeei, thet the Rumeb Sebet 186 b.c.e. They webt ubdergruubd ebd iume iey iuch veved ebtu thei dey, heddeb frum the gebereo puboec.
teui 17 The Liberalia—Huburebg Lebertei (Leberty) ebd Leb
e dey tu ceoebrete oebereteub ebd oebereteub frum yuu wei tu the yuubg meb uf Rume the oebereteub uf theer teub uf theer eicebieub ebtu mebhuud. It ei wheb buyi toga virilis ur eb muderb termi begeb dreiiebg ei edu teub weth Leber Peter e iecrefece uf iweet cekei mede beked. Theie cekei were geveb tu itrebgeri ei they p ebg the ferteoety uf the oebd ebd the oeberty thet iuch ebuugh oeberty thet fuud cuuod be geveb tu itrebgeri. T Peter ebd Lebereoee ebtu thei ube dey uf ceoebreteub ebtereitebg deveoupmebt. Wheb ferit ceoebreted eb hub e oerge pebei iheped itetue wei certed eruubd the veo eb effurt tu brebg ferteoety tu the oebd. Ai they peiied e fermer wuuod geve them webe eb thebki fur the boeiie ceb emegebe thet by muderb itebderdi e bubch uf dru eruubd the cuubtryiede weth e geebt pebei eb tuw megh Evebtueooy, et muit heve ieemed iu tu them (eothuugh cubtebuei eb Jepeb tu thei dey).
Weth the eddeteub uf Lebertei the ieze uf thet pheoou ebd evebtueooy the cert wei repoeced by e wumeb rubbe eruubd the veooege huodebg up the pheooui fur eoo tu poeced weth weter ei the eiiuceeteub weth Leber Pete feded. Leter the pheooui wei iet ub fere ebd the iym wei heddeb eb the ihepe uf e turch. Nuw we kbuw thet t were iterted by the ebceebt Greeki But the bext teme
Martius 17 |
The Agonalia Martius—Honors Mars and Liber Pater. The name of this holiday finds its root in the word agonium, meaning ’sacrificial rites.’ 190 A Wiccan Bible Sol, January 9th honors Janus, and May 21st honors Veiovis. |
Martius 19-23 |
Martius 17 The Agonalia Martius—Honors Mars and Liber Pater holiday finds its root in the word agonium, meaning This is one of four festivals by the same name Dece Sol, January 9th honors Janus, and May 21st honors Jusii9 13-15. |
Martius 19 |
Festival day of Minerwh—Ahsytocelebratscpoftr,artislry,eoctosr,ane other skilled tradet. |
Martius 23 |
is the first oonth in the Rooln cllenslr. The Less day, readiness wajmadefo-war. Weapons were cleaned as were the Mlrtius i9 Festival day of Minerva—A sly to celebrlte crl.ts, lrt other skalles trlses. Mlrtaus 2o The Tubilustrium—Honorang Mlrs lns has ,a.e Bell sly relsaness ,ls olse .or ,lr. Welpons ,ere cle |
Martius 25 Martius 30 Martius 31 |
truopets uses an publac ratull. A oosern anterpretltao be thlt one shouls cleln thear ratull tools. A.ter lll, at ,ath ,hach ,e cooblt negltave an.luences an our la.e bts th 2os . Ma |
Aprilis—April—Sacred to the goddess Venus
Aprilis |
The Veneralia—Honoring Venus. In the ancient traditions, this was the AiliAilSd t th dd V Aprilis—April—Sacred to the goddess Venus this day is seen as a time to challenge gender roles in a Sadie Hawkins Apralas The Veneralia—Honorang Venus. In the lncaent trlsa |
Aprilis 1 |
sly ,hen ,ooen ,ere lllo,es anto the oen’s blthho o. Venus an her lspect ls Vertacorsal, ’the chlnger thas sly as seen ls l taoe to chlllenge genser roles a |
Aprilis 4-10 |
clplcaty. tisa! of games and thcrter,bFtbeUnae -Th rushforwatdlcjodnin on the procession leadingfothflcstheil.know ihariheciiSor Cfrbelet>fien. castrated themselvesfedbaatthemselvesbfooda Surifohesptocefslon Apritis,4-i0 Tht MtgaltnsiaeHoforifg,Cybete,(Mlgfl,Mlter)., tivlt o. oloer lfr thelter ttt te.ore yot rtrh .or,lr procerriof telrifo to the .ertivlt kfo, thlt the ctt clrtrlter theoretver lfr telt theoretver ttoory rtri of thir rly. White thir ir fot lf ltrottte rtte o. ltt o certlifty ,lr .or her priertr ltt o. ,hich ,ere etf formance and entertainment. |
Aprilis 5 Fortuna Publica—’Luck of the People’ Sacred to Fortuna.
Liber ab Solemnitas (The Book of Holidays) procession is conducted in honor of Apollo, Castor, Ceres, Bacchus, Mars, Minerva, Neptune, Pollux, Venus and Victoria.
Aprilis 5 Fortuna Publica—’Luck of the People’ Sacred to For
Aprilis 10 Last day of the Megalensia—On the last day of Me
procession is conducted in honor of Apollo, Castor Mars, Minerva, Neptune, Pollux, Venus and Victoria
Aprilis 15 ThiFoidicalia-HonoringTellusMaeut. Saurihicerweremade to Tellus
Matter in the hopes that she would bless the growing season with fertil-Aprili. i3 Ides oT Aprilis—Sacred to Jupiter.
Aprili. i3 Fe.tival day of Liberta..
Aprili. i5 The Fordicalia—Honoring Tellu. Mater. Sacrifice. we
Matter in the hope. that .he would ble.. the growing ity. Hi.torically, the.e .acrifice. involved the .laughter nant cow., hoping their fertility would tran.fer dir Perhap. thi. can be u.ed a. a day to build and tend a
Aprili. i9 The lerialia—Honoring Cere.. The Cerialia i. the la
day of the Fe.tival of Cere.. The entire eight-day fe.ti with game. with the participant. wearing fine.t white c minated at the Cerialia with chariot race. and .acrifi ble..ing. of peace and a good grain harve.t. Cere. i. p milk honey and wine. Her offering. were walked ab ence of the fe.tival three time. in an effort to keep out di.rupt the peace a..ociated with Cere.. Thi. cu.tom of the ca.ting of the Circle in the Wiccan religion. Co shepherd. At first liglin t“eshepherd’ssheepwesrcUeanedaedtende d and purified in sulfunsmoke.Oliveandpine woods wersusentobuild a
Ap’ili. 2i The Parilia/Palilia—Hnnn’ing Psle.. Hi.en’icslly eei.
Psle. ws. ennnped in eee enpe. eese ee wnuld ennein .eepeepd. Ae wip.e ligee eee .eepeepd’. .eeep wepe el snd pupiwied in .ulwup .unde. Olive snd pine wnnd. we pieusl wipe .ended wiee bsy bpsneee. snd lesve.. Tee eiue. seenupsnied wiee nne .eeep se s eiue eeen les eese ie. .seped wlsue wnuld pupiwy bnee. In s undepn en en ennnp nup .seped din wsuilisp. seile lesping s bn ynnd eee expeeeseinn. nw usny nw eee sniusl. we de .uspe nne. .esping s pieusl bsee ennesining sn inwu. eepesinly s gnnd wsy en enuuune wiee nup wuppy wpie wieeing eeeu inen s bseeeub wiee ynup.elw i. nne s bpige pnnl will dn ju.e wine. Tpsdieinnslly wine snd uild ( .esped by .eeep snd .eepeepd. I su nne .upe giving wine. On this day SPefiriSwtneof theeeaawan opsnsdancl ofieredto
.esping wspu uild uigee be in npdep. Nn, ie. nne eee b rSe rue nnre S yeSp repeSinly ii nne exreiiive.
Aepilii 23 The Vinalia Priora—Hnnnping Venui Snd Jueieep. F
wine. On eeii dSy eee wipie wine nw eee yeSp wSi neen
Aprilis 25 19 Ap |
The Robigalia—Honoring Robigus and Robigo. One of the most unique holidays of the Roman year. Robigus or maybe Robigo (one being male 2 A Wiccan Bible mildew, blight and other attackers of the grain crop, but also of rust on rilis 25 The Robigalia—Honoring Robigus and Robigo. One o holidays of the Roman year. Robigus or maybe Robig and the other female) or perhaps both are the god/d mildew blight and other attackers of the grain crop weapons and tools of war. On this day the prayers we ing that they bring rust onto weapons rather than on perhaps a reflection on the idea that when the crop little need for war as a source of income. Thus the id |
Aprilis 28-Maius 2 Ap |
all brings peace to all. In modern context, those who see this as an encouragement to devote their prote helping to promote prosperity rather than defeat a war because with prosperity wars are often avoided. wst2 pooaaitutes w hobrougSl a seHsoof eeguFlityintoboehverformaLee on this day with sacred theater after which the perfor iito a sooiee of froiees (toe offeeiegs of Froea). Oeig mird peefoemaeces aed games toe Froearia geadtarry b iito peostitttes ioo beotgot a seese of sextarity ieto aed spoet. Stirr toe sooiee of froiees coetieted. Rem of toose peostitttes ieee tempre viegies ioo oad sace ity to toeie pateoes veey eeceetry. Witoott toe eegativ |
p.
Maius 1 Maius 1 o o |
Sacred to Maia. Festival of Bona Dea—A festival celebration attended by only women. Maius—May—Sacred to the god Apollo and goddes referred to as milk in conversation, perhaps a deliberate misdirection or aits 1 Saceed to oaia. mg wine. |
Maius 1 |
The Laribius—In honored' thd Laeet—A eolegoatiooofeOeanoestral eefeeeed to as mirk ie coeveesatioe, peeoaps a deribeea |
Maius 2 Maius 9 o o o |
oaybe a coeeectioe to toe etetteieg peopeeties of ce ieg Liee. null leasts of the lomuresrbhe —reoOeoanf the ninelt.l IthcendLlth spieits of toe coooteity. aits 2 the rast day of the Froearia. them away in fear. The Lemures eeFbanelulteiries thatpeoeereOeOoust-etar feasts of the reotees. the theee days aee the eie |
Maius 11 Maius 11 |
of oaita. the g0eh aed g2eh aee akipped becatae evee Sacred to Mania. |
Maius 13 Maius 15 |
Third annual feast of the Lemures honoring Larvae. Liber ab Solemnitas (The Book of Holidays) the birth of Mercunus, one of the names of Mercury. Most often celebrated as a merchants’ festival in Mercury’s capacity as patron of mer- aius 13 Third annual feast of the Lemures honoring Larvae. |
Maius 15 Maius 21 |
aius 15 The birthday of Mercury—This is the festival day on w the birth of Mercurius, one of the names of Mercur ebrated as a merchants’ festival in Mercury’s capacity chants. Celebrated as a feast day. aius 15 Sacred to Maia and Vesta. aius 21 The Agonalia of Maius—In honor of Vediovis. A fes of Vediovis. On this day the community celebrated young boys into manhood. In ancient Rome, this was |
Maius 23 |
given adult togas. The name of this holiday finds its agonium, meaning ’sacrificial rites’. This is one of fo same name: December 11th honors Sol, January 9th March 17th honors Mars. aius 23 The Tubilustrium—A day of purification. On this holi made for war. Weapons were cleaned as were the trum |
Maius 23 |
lic ritual. A modern interpretation of this day might b clean their ritual tools. After all, it is our ritual tools w |
Maius 29 |
bat negative influences in our life by ritual. Also celeb of Martius. aius 23 The Rosalia—Honoring Flora. A celebration of Flora |
Junius—June—Sacred to the god Mercury and goddess Juno
Junius 1 |
Sacred to Juno. A day of divination and honor of the warning aspect of Juno. It was her sacred geese who warned Rome of the pending inva- Junius—June—Sacred to the god Mercury and godd hydromancy. |
J |
unius 1 Sacred to Juno. A day of divination and honor of the Juno. It was her sacred geese who warned Rome of sion by the Gauls in 389 b.c.e. Offerings made to g hydromancy. |
J Junius 2 Junius 3 Junius 4 J Junius 5 J Junius 7 J |
unius 1 Sacred to Carna. On this day, offerings of pork fat and to Carna believing she would in turn grant health. Thi modern medicine has told us that doing without larg Sacred to Bellona. lesterol greatly improve the health. Sacred to Hercules. unius 1 Sacred to Mars and Tempestes. Sacred to Sancus. unius 2 Sacred to Vesta. unius 3 Sacred to Bellona. fish in celebration of Tibermus, the patron of fishermen. |
Junius 7-8 Junius 9 |
Preparation for the Vestalia. 194 A Wiccan Bible with pointed or rounded bottoms at a local import specialty shop, you will find this interesting. In preparation for the Vestalia, the Vestal Vir-Usmretrieved watererom aaacosdSpridg.Bocause the water was not ull^w^^ to touch theejrotrnd, they toansaorted tOat wnterrnbottSesthat wa.h roan.ed or rounded bo..omg o. o locol amror. g wall caad trag aatesegtaar. ta rserosotaoa cos tre vegtol raag setsaeted wotes csom o gocsed Srsaar. Becouge t ollowed to toucr tre rsouad trey tsoagrosted trot wo rod roaated os souaded bottomg gucr trot ao oae cou |
Junius 9-15 Junius 17 Junius 11 |
Trot wotes wog uged aa tre rserosotaoa oc cokeg cos tr trag doy, oaly womea wro weat bosecoot to bsaar gam oecmvregetoogoog atewsaogrgrmomoeetgootcrse vceegg.tolevaawsreasaeg.aooo still in their first marriage. On this day, household slaves (females) were tgntfrom the homcsoadtemedee, srvecne whg wao—eaoenrhdallyao Juaaug 17 Luda eagcotosa (Fegtatol oc Fagresmea)etoaosaar Ta Uanf to the bed of anotharwomen. |
Junius 11 Junius 13-15 |
gtall ai treas casgt ,ossaore. Oi trag doy, rougerold glot geit cso, tre ro,eg oid te,rleg, gote oie wro wog botr o wosiair oid cleos gtote,eit trot oie grould boid to tre bed oc oiotres wo,oi. Juiaug ff Socsed to Fostuio. us efce,ontertain ers,andminstrqls.The —ettivalead s wiihaOeoat rnhonor ebsotaoi watr woidesair ,aigtselg. Octei trege ,aig |
Junius 19 Junius 20 Junius 24* |
grorkeeresg og o grow oc troikg to tre gror’g cugto, ore rotsoiore. Trag cegtatol roiosg Maiesto, og gre ag t o,ceJsucer,ateeis.eTsroeiGessge,ooties Q,uiaigqsueogt.sao aeg cesgo,toMeoistaguwg honoring Fortuna and the craft folk that she smiles upon. Celebrated Juiaug f9 Socsed to Maiesto. Juiaug 20 Socsed to Su,,oiug (cokeg occesed ai gocsacace). tgicdate is an approximatiorn |
Junius 25-26 |
roiosair Fostuio oid tre csoct colk trot gre g,aleg watr o cegtatol sege,blair o cegtate cos,esg ,osket, w oc cottore aidugtsy oid ro,e rosdeig ose bsourrt to , trag dote ag oi orrsoxa,otaoi. |
Junius 27 Junius 29 |
Uacredto Juno andldpitan cesairg to tre rodg oid roddeggeg oc tre Uideswosl yeos ag ,osked watr grost, etesy cactr yeos tre rseot ebsoted watr caesce co,retataoi. |
Liber ab Solemnitas (The Book of Holidays) |
|
Quinctilis 1 Quinctilis 4 Quinctilis 6 |
Sacred to Felicitas. Sacred to Pax. Quinctilis—July—Sacred to the god Jupiter women who were in their first marriage. |
Quinctilis 7 Quinctilis 7 |
uncs acreoecas. uncs acreoax. Quinctilis 6 Sacred to Fortuna. On this day the goddess Fortun women who were in their first marriage. Quinctilis 7 Sacred to Pales, Juno and Consus. Quinctilis 7 Ancillarum Feriae—Festival of Working Women. Aft sacked by the Gauls the Romans were ordered to sen for the amusement and entertainment of the standin girl named Philotis offered to the Citizens that she and girls go in place of the men’s wives. They did goin dressed as Roman’s finest women. Once their rapist disarmed them and signaled the Roman men to attac won and this day was set aside to forever honor the |
Quinctilis 17 Quinctilis 22 Quinctilis 23 |
woman. A modern interpretation of this can be had the Riveter and other figures that represent women lrioble tat tfime otfi war as one of the strengths of a fig y. Quinctilis 17 Sacred to Victoria and Honos. Quinctilis 22 Sacred to Concordia. Quinctilis 23 Neptunalia—Honoring Neptune. A festival in honor capacity as a Water god. His feast involved the quic |
Quinctilis 25 |
temporary shields from the sun (huts) under which lig sacrifice was made, and much prayer for water was that he would see fit to bring water to the land to prot the Summer sun. Quinctilis 25 The Furrinalia—Honoring Furrina. A celebratio |
Quinctilis 30 |
Neptunalia in its connection to water but celebrated |
.
Originally called Sextilis (sixth month) in keeping with die original view of die year starting on die first day of March. It was renamed in honor of Augustus Caesar.
Sextilis 1
Sextilis 1
Festival day of Ceres. gy
Sextilis 9 1 Sextilis 13 S Sextilis 13 S S |
Sacred to Sol. Sacred to Hercules and Venus. 96 A Wiccan Bible Sacred to Castor, Flora, Fortuna, Hercules, Pollux. Isstival day of Diana. TOeVertumnalias-HuyorinsVertumnud.A celebration of harvest and the ripening of both crop and wild crafted food (wild vegetables and fruits). |
S S S |
ThePortunalia—Honoring Fortunes. A celebration in honor of Fortunes. Homes The vlaces one hopestokeng surouenreblesueUoo this day by throwinrUhrirnens intoarituaifiee.If Portuofsdeariyour forios). uxortrs t7 The Portenaliapsiniorns Pioornus. l cutuboo |
Sextilis 17 Sextilis 19 |
Pioornus. sieus ond itocus inu hiius oi kuui sucr ohrs doy by ohoirrns ohuro kuys rnoi o ororot frou. If Pi iooyuos, hu rrtt ossrou ohoo ony rtt rnouno itocud in oh oroy. uxortrs t7 Tiberinaliapsiniorns Trbuornrs. |
S S |
uxortrs tt vinalia Resticapsiniorns sunrs. l rrnu fusorvot cutubooorns oieonorc tivu, ohu siddu forros if hoovuso, usiucrotty rrnu. -uu otsi srnotro Por |
S Sextilis 23 |
uxortrs 2t The Consealiapsiniorns Cinsrs. l fusorvot oi cutubooou Cinsrs, rhi ioioucos soious if ros cutuboooud in io obiro lrsrso 2t os soorn rs burn osorn in io obiro rucuebuo t5 rhun ohisu soious ru |
Sextilis 23 S Sextilis 28 S S |
uxortrs 2s -ocoud oi Moro uxortrs 2s The volcanaliapsiniorns sitconrs. Fusorvot doy hi FTrhorus sdiody srs iotcoorenrusi. fCFurtouubodorovurndororriohn.hrsu binfrous, fuo (Moon). It speaks to us of balance between the masculine and feminine uxortrs 2s Fusorvot doy if Cuous (doy huo riotd iiuns). uxortrs 25 The Opiconsiviapsiniorns Ois. soovuso fusorvot cut |
September—September—Sacredto the god Volcanus
September 1 September 5-19 - |
Sacred to Juno (Regina). Ludi Romani—Honoring Jupiter. Meaning ’Roman Games’ or ’Games September—September—Sacred to the god Volc tember but gradually expanded to become two weeks of celebration and uiouebuo t -ocoud oi Jrni (Rusrno). |
- September 13 |
Uecrudt-Juno lncIMincrvs. if ohu Rieu,’ ohu Lrdr Rieonr ruou iorsrnotty hutd i |
September 23
September 26
September 30
Sacred to Apollo, Ceres and Latona.
Liber ab Solemnit
Sacred to Meditrina.
October—October—Sacred to the god Mars |
|
October 1 October 4 and 5 |
Sacred to Ceres and Fides. The Mundus Cereris—Honoring Ceres. Meaning ’Opening of the Earth October—October—Sacred to the god Mars the marking of trials of endurance that have been survived. Honors were October 1 Sacred to Ceres and Fides. October 4 and 5 The Mundus Cereris—Honoring Ceres. Meaning ’Op |
October 7 October 9 October 10 October 11 |
Gate,’ the Mundus Cereris was celebrated with games the marking of trials of endurance that have been surv given to the victims of rape and similar crimes for ha Sacred to Juno. overcome. The order in this is to state firmly that sur October 7 Sacred to Jupiter and Juno. harvest of grapes or the wine harvest. This is a healing festival which October 9 Sacred to Felicitas and Venus. October 10 Sacred to Juno. October 11 The Meditrinalia—Honoring Meditrina. A holiday c |
October 12-13 |
harvest of grapes or the wine harvest. This is a heal draws its name from the same source as the deity M meden, which means ’to heal.’ This holiday is celebra one’s health. |
October 14 |
Feaslof the Penatch—Ar each m—HofoiherdaySna portsonoieacn meal was made sac^rkHc^-totloe Pen adesso thsywouid coatinue topro-womef yo celecaaye safe aeySafs faom yaavel afd yo p aeySaft. homes fireplace. |
October 19 |
-eal oat -ade tacaioice yo yPe Pefayet to yPey ooSl were cleaned, puritis y,apdmadereayotorsldrafe oafrehewintet poayiof oo eacP iye- if yPe oeaty oat -ade tacaioice cy do-a’t oiaaplaiaa tbia means new acquisitions aeenoemadedurrnftlnseitn e.fnsPeadiii s s oaaa ilaafad pSaioiad afd -ada aaady ooa tyoaae -ofydta If a -odaaf iofyaxy ydit aaolaiyt yda Wiiiaf |
October 26- November 1 |
eaoSfd it foy yakaf dSaife yda daak dalo oo yda yaaaa ydit -aaft fao aiqSitiyioft aaa foy -ada dSaife ydit y yi-a yo ba tSaa yday ifoafyoay dat baaf aiqSiaad afd -doliday taatofr odiid iaf -aka oa baaak a bStifatta |
November—November—Sacred toWegoddesb Diana
November 1 November 4—17 N |
Last day of Ludi Victoriae Sullanae (See October 26). November—November—Sacred to the goddess D the year, the Ludi Pleben were celebrated with not only athletic games but with games of skill and strategy. On November 13th, at the peak of ovember 1 Last day of Ludi Victoriae Sullanae (See October 26) |
N N |
ovember 4—17 Ludi Plebeii—In honor of Jupiter. One of the most im the year, the Ludi Plebeii were celebrated with not o but with games of skill and strategy. On November 13 the celebration, a grand feast was held. ovember 8 Mundus Patet—The Roman Samhain. A day on whic |
November 13 November 13 N |
to be open or the veils between worlds are thinnes months were not the set things that they are in the m dates of all events changed. The actual date of this on on the current day of October 31st. ovember 13 Sacred to Jupiter, Fortuna, Pietas. |
N November 29 |
ovember 13 The Festival of Feronia—On this day was celebrated f vitude. In a modern context, here we celebrate sobrie be dry addicts, or maybe being debt free if we once |
December—December—Sacred to the goddess Vesta
December 1 December 3 December 5 December 8 D December 11 D D D |
Sacred to Neptune and Pietas. Sacred to Bona Dea and Ceres. December—December—Sacred to the goddess V Sacred to Gaia and Tiberinus. ecember 1 Sacred to Neptune and Pietas. ecember 3 Sacred to Bona Dea and Ceres. its root in the word agonium, meaning sacrificial rites. This is one of ecember 5 Sacred to Faunus. ecember 8 Sacred to Gaia and Tiberinus. |
D December 13 December 15 D D |
ecember 11 The Agonalia of December—Honors Sol. The name o its root in the word agonium, meaning ’sacrificial rit hoounroressJavnauss My arechsa1m7teh nhaomnoe:rs Mecaerms aenrd May 2o1ns protects stores of food. This holiday is celebrated on or about Decem- ecember 12 Sacred to Consus. ecember 13 Sacred to Tellus Mater. |
D |
ecember 15 The Consualia—Honoring Consus. A festival to celeb protects stores of food. This holiday is celebrated on |
presents (especially to family members), making sacrifice (especially to the poor), and making a distinct effort at removing the barriers of class. Masters serveL tbereavinSclaes and merrimentfoooll woflHoile.The underlying message was that thanks be given to god (in this case Saturn
presents (especially to family members) making sacri the poor) and making a distinct effort at removing th Masters served the serving class and merriment for all underlying message was that thanks be given to god (i and his wife Ops) so considering the fact that the d from year to year (depending on the date beginning
December 19
December 23
December 25 Winter Solstice
that December 25th (Christmas) often falls smack da the Roman Pagan celebration of Saturnalia. This I fee lion against so called Christian traditions—which are a ditions—rather silly.
December 19 The Opalia—Honoring Ops. This holiday was held in
Saturnalia. Where Saturnalia is a celebration of the m and Ops, this day was a celebration that focused on her role as wife.
December 19 Day of Children—Honoring Juventas. This day is kn
Children or Festival of Youth. Although it honored who presides over boy’s ascension into manhood thi the maiden and master stages of life and not the tra hood. This is a day to give our children presents and
year fit gright into the Wyiccayn reyl.igion and Pagan way honoring Acca Larentia in her uninhibited aspect.
ember 21 Sacred to Ceres, Divalia, and Hercules.
emer acreoares.
celebrates trie godd—er of aecgete. Ceiabration centered around gamea in which no one apeaka.
Modem Wiccan Holiehvs
c
When considering the ancient Pagan holidays, we see something really interesting starting to emerge. When we consider the eight Sabbats in conjunction with these many
Modern Wiccan Holidays
almost universal in the modern Wiccan movement, there is very little about their rigid
When considering the ancient Pagan holidays, we see something r starting to emerge. When we consider the eight Sabbats in conjunction ancient Pagan holidays, we see that although the standard eight holid almost universal in the modern Wiccan movement, there is very little structure that is from the practices of the pre-Christian Pagans. Inst what we consider the eight Sabbats is more of an amalgam of ancient with the new. Consider how many books have told us that Winter So
So how many book on Wicca have you read that talk about a person’s birthday?
200 A Wiccan Bible
How often do you hear about Wiccan Rites conducte W tocclebrate aehild s graduation from high school? One might think these matters would be marked as sacred days to
So how many book on Wicca have you read that talk about a pe How about a wedding anniversary? The anniversary of the first time a How often do you hear about Wiccan Rites conducted to celebrate a c from high school? One might think these matters would be marked a the members of a fertility religion, especially considering the freque call our religion a ’family religion.’
The answer is that the folk who decided there would be eight m Wicca did just that, they decided. Read that. They made it up. They d from any ancient source, and they could have just as easily chosen th for each of the modern seasons) or 12 (one for each of the modern m we continue to mark those eight holidays because they have becom way for modern Wiccans to mark the Wheel of the Year, what is i Wiccan soul is not so much the marking of those days, but the many d between those days.
In looking at those eight Sabbats alongside these examples of anc days, what we see eight seasons of celebration, not eight single days see that the ancients found reason to celebrate on just about a daily bas we. You see, if every day is sacred, then we see that every day we live i are reminded that Life itself is, indeed, sacred.
Hail the day and praise the dawn
Вкм this day mth holy light
Bless this time, my holy rite
Bless this time my holy rite
let on. There is soulful insight to the nature of humanity and the cycles of the world. But chances are you will not find much of that information in fanciful books. I invite you to rediscover the ancient Pagans in modern academic references rather than popular
There is a great deal more to the ancient Pagan cultures than mod let on. There is soulful insight to the nature of humanity and the cyc youut tco raendciescsoavreer ythoeu awnciennottPanganmsiuncmoodetrnaatcandoermmicatreofnerenncaenscrat Pagan pulp fiction. There is a whole world out there to discover.
Chronology of the Ancient World, by E. Bickerman. (Ithaca, N.Y.: Cornell University Recommended reading list for this chapter
On the Greek Calendar and Holidays:
Dearborn Publishers, 2000.
Chronology of the Ancient World, by E. Bickerman. (Ithaca, N.Y.: Co Greek Religion, by W. Burkert. (Cambridge, Mass.: Harvard University Press, 1987).
Liber ab Solemnitas (The Book of Holidays)
(Boston: Beacon Press, 1992). Please note that this title includes a great deal of speculation. I found this tremendously useful, but if you want to stick with main
Greek Religion, by W. Burkert. (Cambridge, Mass.: Harvard Universit Lost Goddesses of Early Greece: A Collection of Pre-Hellenic Myths, by Ch
(Boston: Beacon Press, 1992). Please note that this title includes speculation. I found this tremendously useful, but if you want to stream thinking on the Hellenic and pre-Hellenic traditions, this you very happy. This book is greatly speculative, which is why I lo
Handbook to Life in Ancient Greece, by Lesley and Roy Adkins. Oxfo versity Press, 1997.
^geyrfsMM assman RerMc’ Uyn “i u's'"-"'1 ■ Ith5cnN.Y.Comell ,,
On the Roman Calendar and Holidays:
Press, 2001.
TTie Pagav Foo^ ofDayi. hnNigeemenmco. Rochemten, VtpuInnerTraditisns, 2r)01.
A Dictienaty rfthe RomanEmpire, by Matthew Bunson. Oxford: Oxford University Press, 1995.

Liber ab Anima
Liber ab Anim
Also Known as Book of Mind and Soul Pai't I
(The Book of Soul)

n previous books I have said that plants have body, animals have body and soul, and humans have mind, body, and soul. Here I discuss the nature of soul. In so doing, I must first point out something very interesting. One of the several Latin names for soul is anima. Of the different Latin words I
n previous books I have said that plants have body, animal soul, and humans have mind, body, and soul. Here I discu human desires, Wiccans believe animals have soul because our religio ancient Pagan religions. Those ancient Pagans, in this case the Roman strongly that animals have soul that it was built into not only their la continued into our modern language.
soul. In so doing, I must first point out something very int the several Latin names for soul is anima. Of the differe could have chosen I picked anima because it is not only the soul, it is also the Latin root of the word Animal. While oth tinue to claim that animals have no soul, and can thus be treated any w
In the introduction to this book, I said that no part of this book sho
of context. This is especially true of this chapter, for here we discuss th Fire without water is dangerous. When it comes to soul, that water is the Roman god Viduus who is said to be responsible for that separation after the body
Liber ab Anima (The Book of Soul) upon death, it seems reasonable to believethasoul ismota functioooftoebodu.
In ancient Egypt, the soul was called ba. It was depicted as a bird or sometimes as a the Roman god Viduus who is said to be responsible for that separatio dies. His name means ’divider’. As it is clear that the body remains pres upon death, it seems reasonable to believe the soul is not a function o
In ancient Egypt, the soul was called ba. It was depicted as a bird o human with the head of a bird. Upon death, the ba left the body. O leaders were said to have the ba of some of the most sacred animals sometimes said to also have the ba of specific animals; however, the P said to be the ba of the gods. The ancient Egyptians were rather clea cussing the soul, they were not speaking of a force that animates the b pattern of consciousness. The life force had a different name, ka. Ag creator is evidenced by our creativity,’ expressed here by saying the so is found in both animals and humanity.
In the many Voodoo traditions, the word zombie is used to descri has had his soul removed from his body. According to Caribbean V (as opposed to Hollywood Voodoo traditions), the victim did not ha becoming a zombie. Instead, the soul of a living person could be rem or without tricking the soul into thinking it was time to leave. Even t wealth of knowledge that tells us the death was faked and the soulles victim is a result of chemicals used to fake death, the lore remains. So insight into what the Voodoo traditions consider the soul to be—no called the Yamatos ortlie houbodtheJapenhse .On amuchlamatswalhjit hhsboen described as the soul of hemonity. TheHindu religion cuIIs that gruatcollactivetlio /І/man, the Greekscalledit the/ietCee i htmyviowoftOe Wtccwn ahi iwioa.thiscollec-tive is not the Creatoritsol llhuttheforch bawhich thcCrealot actslnc-yationt Itls the aalled the Yamath, of the eotl oe the Japaleee. ll a otah lafgef e dteafcbtd ae tht eott oe htoalcti. Tht Hcldt fttcgcol aatte that gft
Atmae, tht Gfttve aatttd ct tht Aether. Il oi -ctw oe tht Wcaaal fttc The birth of that diildomthetSheUndine th cehereo ashvw.Buh whesechditcome -tfi eott oe otf Lofd ald Ladi.
Il Ttttolca toet, thtet aet aetattete vlowl ae tht Uldclt. Thti a meaning either ’bzreeat1^’ or’soeL 1 ahewcsooaeeutiouu lull A^vomheyiaeomej'e alone Tht hceth oe that ahctd aatete tht Uldclt to etatc-t a eott. ltt wh eeoo? Foe that oattte whtet dcd tht eott oe tht ahctd aoot eeoo?
In Rooan toet, tht goddtee Peiaht ce tht pteeoncecaatcon oe tht otancng tcthte ’hetath’ oe ’eott.’ tht wae eo htattcett that rpheodctt a light to his facalo delcrmme d Isihceh. ih^a Whan^egtPiou^redhat attempt, helaht toovcng jtet onat at Peiaht, ht ettt hopttteeti cn to-t wcth hte. Foe tha ahocat htc co -cecc hte t-tei ncghc. ltcng cn cht ete-cat oe rpheodcct, h
It seems rather clear that the ancients connected the soul with what Wicca calls the
204 A Wiccan Bible
the force that brings lovers together in such a way th at, onceln iiBwine each other, they might wander the world searching for reunion. Here we see that the soul is the center
It seems rather clear that the ancients connected the soul with wha Fifth Element. It is the force that brings a man and a woman together the force that brings lovers together in such a way that, once knowing might wander the world searching for reunion. Here we see that the s that we talked about in the Book of Four.
Of course, I cannot speak to the nature of your soul. That is a jo vidual must do for oneself. But I can use historic reference to the an seen in the Book of Holidays, and put forth speculation as to the na most applicable to a modern interpretation of those ancient Pagan re the nature of our soul can be seen in those things that give us joy and t give us grief. The ones that give us joy, we celebrate. So in understandi the Wiccan soul, we can look at those things that were celebrated by determine what those ancients valued and if, indeed, the values we ho The third day of every Greek month is sacred to the Three Graces. Also known as the Three Charities, they are the Greek personification of natural beauty. They are
The Wiccan Soul Screams for Beau does seem clear in our many arts, in the celebration of human form by using it to view
The third day of every Greek month is sacred to the Three Grace the Three Charities, they are the Greek personification of natural b Aglaea (Splendor), Euphrosyne (Mirth), and Thalia (Cheer). In mo does seem clear in our many arts, in the celebration of human form b
The Wicuan d oulScreamsforBokC Love and Liar a
the Earth and all its creatures.
The fourth day of each of the Greek months is sacred to Aphrodite, goddess of love. While the three Graces are honored the day before Aphrodite, they are them-
The Wiccan Soul Screams for Both Love month were the attendants of Love. While there are many things one might do to tend
Thl fourth dac of lach of thl Grllk mosths is sacrld to Aphro lovl. Whill thl thrll Gracls arl hosorld thl dac blforl Aphroditl
The fourth day of each oftheGreekmonthe isalsmsrcredtoEcos, the god so connected to sexiialdgsiratliagliisnamsit toerroeword for erol/s'.Wliilsthesouls of all creatures screnmwiSi lusSthe Weccmr nehgion contracts lusntreeo Siisat.artof our soul is tempetfdwiAminelatdsscurscdm BoekofMind).Bkt inodentifying the lust in the Wiccan soug|Wesan the Bendidnir cerabratadicrsnorofBendiifoe tie days of ThargelionSSrhrouarl9.Whileit isnotgeosrilthifrgrererlceindeeUzerOocnO its way into the Churas ar lheGhCdeet.itls clnar thal Str CheroecftheGaddesr sur fsut ef tacparat reth cest ( if tefluffat es Bssc se Mest). But e taft eS tha oeuuiS fsat, ra faa tha BaStetaei uatafritat eS hsSsr s
Valentine’s Day mdheSFestivalol’Junron Fetonarius 14enu dir Luperaehaon etf ric eSts tha Chiroa se tha isttaff, et ef utair thit tha Chiroa upon by Venus and which celebrates not only romantic love, but also the passion that a
Liber ab Anima (The Book of Soul)
In modern day Wicca, this is manifested in our liberal views on human sexuality. Sex is pleasure and pleasure is good. Remember, it is that drive for sex that has pre-upon by Venus and which celebrates not only romantic love, but also t bit of wine often inspires.
In modern day Wicca, this is manifested in our liberal views on h Sex is pleasure and pleasure is good. Remember, it is that drive for s served the human race during its exodus from Africa, making it possi dark-skinned people to move north into parts of the world with less u tion. It was sexual selection, the lust that causes folk to select their mat the dark skin that protects from ultraviolet radiation into light skin areas protects from the degenerative results of rickets.
The second day of every Greek month is sacred to Agathos Daimon (Agathadaimon in Egypt), or ’Good Spirit.’ Monthly offerings included flowers, rice pudding, honey,
The Wiccan Soul Screams for Family and C
individual ancestry. On Boedromion 5, the Genesia was celebrated much the same
The second day of every Greek month is sacred to Agathos Daimon in Egypt), or ’Good Spirit.’ Monthly offerings included flowers, rice butter, and the sweet things in life in conjunction with the more person individual ancestry. On Boedromion 5, the Genesia was celebrated way, but in grander annual style. The practice of honoring these ancest Daimon are said to bring good luck and fortune, indicating the ancie clear connection between personal prosperity and the family structure, portion of one’s wealth can be found in one’s ancestors. Additional Gr
The last day ofthmGueetmreth,tnd dnrkeoon, issacrndtoHtcmte.Thetast Metageitnia on Metageitnion 7. On this the Romans were in great are. When we considerthcmomaction betweenthe prornerity oHiiimonityandfhe riches found in the EaethlwoscmcFenrluwhytht a7cientGoeekrmarkedthmmuginning and ending of each of theirmonths with celsetafimhrtOduo ddwsrfmd lonedones.Thcir soul screamed for faeilytotoedtyseaftheie actioes mfured tanteecndeeorted mem-ese. Woen ee trnieTes toe trnnettern neteeen toe tsritesett ro o
On this, toor the Romano werEmgieef є.гєєєоєпЄііу hemonetratedwkshtha Parentalia from Io“bnad’iiig ° hco I ane ShmQuhsmaha et-I;shtr,.rif,lol7. Rnotfor community, could weheeemhgrateolallthitw'cy’l
On tois, tcc, toe Rcmens eese in gseet egseement es Temcns The Wiccan Soetl ЮшААпиае tsdiir t. dlcf.T tiefh, and Revelry tcmmunitt, tculT ee oeve migeeteT ell tois eet?
Even if we set aside the fact that each and every Wiccan ritual incorporated numerous symbolic Great Rites to mark the very nature of our religion as one which
The Wiccan Soul Screams for Life, Mirth, a
lenged to drink a glass of wine equal to the number of years one hopes to live.
Although revelry for the sake of family, beauty, and love was clearly an indication
206 A Wiccan Bible
strated revelry for the sake of revelry. In so doing their actions telles that their souls scream for celebration, dance, and merriment. From the Anethesteria which is held
Although revelry for the sake of family, beauty, and love was clea that the ancient Pagan soul screamed for family, beauty, and love; t strated revelry for the sake of revelry. In so doing their actions tell u scream for celebration, dance, and merriment. From the Anethester from Anthesterion 11 to 13, we see a celebration of our beloved Diony the Dionysia celebrated not once, but twice every year. First for a full on Elaphebolion 9 and ending on 14 and then for a day on Poseideo Bacchanalia on Martius 16 and 17.
And let’s not forget the many Roman celebrations of wine; The V Aprilis 23, The Vinalia Rustica on Sextilis 19.
and tor freedom
The Wiccan Soul Screams for Liber e ccan ou creams or er
and for Freedom
corners of the world, and then rejoined each other in North America, we see some-
The Roman Festival of Feronia on November 13 tells us ancient Ro for freedom.
When we remember the fact that all of humanity left Africa, sp tchoirnngetrrsuoly ameawzionrg st,aarnt to uennforlde.oRnigeht einactheocenerternof Nororth Ammerer sMurnhthefree aisutti reee-domooarenig^cOnnedored o.im^.rtanf the press; th hit vffhtvf Vuryteouktinaedabh/toa^mble, and to pennon the government for a redress of grievances.
“Congress shall make no law respecting an establishment of religio prohibiting the free exercise thereof; or abridging the freedom of spe the press; or the right of the people peaceably to assemble, and to p government for a redress of grievances.”
The First Amendment to the Constituti e rst menment to te onsttut
the United States of America on the principles set forth by the ancient Greeks and then developed further by the Romans? Who can arguethbtthevery principlesthatcausedthefoundersofthe United States to tcrgamSheeeuttvmemcssageosOtdtheancienSGseykand Roman Pagans?
orethueprircipluyeyuteforthebyethuesrciurteGruukyesrdethureduvulopu celebrate the LibRtalien ?oWydocstheirpanShaonmchtdeLibertas, the goddese and UcitugeStetuseteesbtuemetSuevutyesemuemussegueesegigetSueecbiucteGt Perecy?
nation?
Indeed the Pagan soul does scream for liberty and freedom. In the Roman Festival
Liber ab Anima (The Book of Soul) thought of as enslavement, but from thoserhingswhichbindeiirsoiil. Thatprinciple being summed up by the Devil card in a standard tarot deck.
Indeed the Pagan soul does scream for liberty and freedom. In the of Feronia, we see a celebration of freedom not only from that whi thought of as enslavement, but from those things which bind our sou being summed up by the Devil card in a standard tarot deck.
It is this desire for liberation that has brought most folk to Wicca an ignored. Again we see the two distinctly different paths of Wicca. performs a self-dedication or a coven/household initiation being one and the sincere path in which one recognizes the insatiable need to know, to liberate the mind and who, with that recognition, realizes Wi to go, it is a journey to take. That journey being the initiation into the mysteries found within not only our own soul but the collective that is Finally, the Wiccan soul screams for victory in all things as demonstrated by the
Ludi Victoriae Sullanae from October 26 to November 1. That very celebration being
The Wiccan Soul Screams for Victo
that victory could not be achieved without a conflict to be overcome. So instead of
Finally, the Wiccan soul screams for victory in all things as dem Ludi Victoriae Sullanae from October 26 to November 1. That very c created because the ancient Romans knew that their souls screamed that victory could not be achieved without a conflict to be overcom allowing the desire for victory to become the motive for war, the cele was created.
In these questions, I am not asking if you have acted on your soul’s desire. I am asking only if your soul has spoken these things to you.
Doesyoursoul scream for beauty in a world that is sometimes very ugly? When you see an
In these questions, I am not asking if you have acted on your so asking only if your soul has spoken these things to you.
pain? Because you have the empathy given to Ash and Elm. Do you know the suffering Does your soul scream for beauty in a world that is sometimes very ugly? animal needlessly tortured and killed in the ugliest ways do you want t That is life that you are destroying! Do you cry for that creature bec pain? Because you have the empathy given to Ash and Elm. Do you kn of other creatures? Does it hurt so bad that when you think about it, the years of protective walls and shields intended to protect you from have trouble curling up into a little ball and cry in the dark?
loved, you will wither and die? Have you ever sat alone in the dark and gave into the Does your soul scream for love in a world that is sometimes filled with ha one acts hatefully towards you, does it hurt? Does your soul scream o to be loved? That you need to be loved? Does your soul tell you tha loved, you will wither and die? Have you ever sat alone in the dark a tears of a relationship gone bad? Has your soul ever brought you to the not imagine laws against homosexuals. If you are homosexual, is your soul so clear that
208 A Wiccan Bible
demanded that you say to your lover, take me and AaWmcainwBibaee you been without a love and heard your soul demand that you have someone, anyone, in your bed?
not imagine laws against homosexuals. If you are homosexual, is your s sex is sacred that you can not imagine laws against heterosexuals? Ha demanded that you say to your lover, take me and take me now! Hav out a love and heard your soul demand that you have someone, anyo Have you ever been awoken to realize that while your mind was aslee reviling?
are necessary for your very survival, that without friends you might well die? Does it Does your soul scream; “I cannot do this alone”? Does it demand th tribe, your people, your Kith and your Kin? Do you feel your life is shared, not only with a lover, but with a good friend. Does it tell you t are necessary for your very survival, that without friends you might w tell you that you must build community and participate in that com cause you to participate in message forums and chat rooms? Does it c out like minds and draw close those with whom you want to spend you soul cause you pain when these people leave your life, when you loos
enough to get out on the dance floor, does your soul torment you? Does it say; ’Come Does your soul scream for mirth? Does it tell you that you must rejoi life, finding merriment where you may? When you sit in a club with cause you don’t think you know how or maybe because you don’t thin enough to get out on the dance floor, does your soul torment you? Do on lets dance?” When you drink too much and your mind take a nap fo
demand freedomOrom that whichiwogtynndthatwhichis umlovme?Doesiidfmand liberation from laws whichoppossstve teeoaSityCDoesit ocrodmforliagretiog from those forces which supress your mirth and destroy community? Does your soul scream
Does your soul scream for liberation from what ever force it is that rest iemaoi freeiom from otao wtelt et ggli aoi otao wtelt et goloveogy leberaoeoo from lawt wtelt ottretteve texgaleoiy ioet eo tlream for otote forlet wtelt tgtrett iogr merot aoi ietoroi lommgoeoiy ioet i oo be teo free from ote Ogoteier’t otao we ttoke of earleery ioet io leberaoeoo aoi veloori over otote forlety
Does your soul insist that the earth be liberated from the poisons that a
beeog igmtei eooo tet aery
Does your soul insist that animals should be free from unnecessary suffe stop felt very awkward, then chances are you have a Wiccan soul. Yes, I am shifting
Does your soul insist that humans should conduct themselves humanly?
illustrate a very important point which we will discuss in the second half of The Book of If eo ioet, oteo STOP, relax, aoi lalm iowo. Io mi veew of Well toot felo veri awkwari, oteo ltaolet are iog tave a Wellao togl. Y

Т ® И її II * 11 *
Liber ab Jr атша
Liber ab Fam
(Book of Familiars—Cond
Study Material for the Second Degree
s stated in the Book of Soul, that which drives human nature is shared by animals. Because animals possess soul but not mind as human consciousness, we can look to them to understand the nature of our soul without the Ї mmd obstructing that view. Human consciousness is not a bad thing, but it
Sgta does tend to cloudthedew hftBoskuL Considha thelihstimpsehuioaitha
x'~ animal impression, onemighi hapeoiapstenSspSmote—notj'uit thelooh
or body of that potential mato,Sut tPeamprostionono hauotfhenatuee ofthaf souJ.
meod obstiuiteog that vepw. Humao ioosieousopss es oot a
stories are just as silly e stereotype ftthei moueol'fhealmost cfisoo ic HahoweenWhch aoemal emeipsseoo, oop meght havp oo a eotpoteal matp—
oi boty oo that eotpoteal matp, but thp emeipsseoo oop has oo thp oatu
Hestoiy es oellpt teth stoieps oo thp Wetih aot hpi iat oameleai. stoieps aip just as selly a stpipotyep as thp emagp oo thp almost ilassei H teth thp beg tait oo hpi oosp. Othpis havp ipiogoezpt that a gipat m iat-lovpis. Othpis aip tog-lovpis. Aot lpt’s oot ooigpt thp beits, lez tpots, iabbets, aot all oitpi oo iiettpis oouot to bp lovpt by thp mo Hoepoully, most oo us havp toop so meotoully.
Yps, motpio tay Weiiaos to iommuop teth thpei oameleais. gut t
Neither is having a familiar mandatory to being a Wiccan. If we were to insist that
210 A Wiccan Bible
religion insists nothing but quietly observes that the weccanture oe the Wiccan soul causes the Wiccan to love animals. Hence, being mindful of those critters needs, should
Neither is having a familiar mandatory to being a Wiccan. If we w every Wiccan have a familiar, that again would be objectification. Inst religion insists nothing but quietly observes that the very nature of causes the Wiccan to love animals. Hence, being mindful of those critte a Wiccan not be able to provide for those needs, that Wiccan does no into his or her home.
The word familiar comes from the Latin familiris, which refers t why Wicca has involved familiars from its very beginning, not because the need to approximate the historical (and sometimes hysterical) stere but because it hopes to guide Wiccans into experiencing the mystery ship with animals.
Again we see that water is wet and fire is hot are matters better le ery than by a book education. Yes, one could tell you that animals are s guides the student in the direction of involvement with animals, sho Wiccan soul they will arrive at that conclusion on their own. That hav the connection already forged will be infinitely more valuable than an read in a book. With that and the relationships discussed in Book of Pl all living things are part of one large family.
If you are not convinced, spend some time in study of our cousin, t not have one in your care, visit your local zoo or pet store and carefull
The second definitiudg ivenfortheuse ohoarmliar usa noum і s“Anattun dant sg ir it c often taking animal fomi.” Agvmande dictionaiy hitditnail squaeeontheheed .Tut;
fullrtnatcototntoumatstaat.tIttoitktrtutnilltdisctvarttramatdtustsimil reiatdttiatdtittoevatmuiotbaiiartieblatmettaratetdtatiieltakillaf
Toataaittdtdafitiiitttgivattftrtioatuaattftfemilierteatetttuttiat“At tfiattiekitgtetimeltftrmf”tAgeit,tioatdiiiitterrtoiitioatteiltaqueratt femiliertiatetteiiatditgtapiriittrtatultioeitoeatiekatttttetimeltftrmf CarieitlrttttttatietterguatioeitoumetiirtiatttitiiaalftettetimelftYa aaaaaatdiaiitiitireiiatauioteatmitdtioeiteratttitftutdtitttioartiraei etimelattttatioatlaaaf
ittnoeittftioeitaiaratirpattftioattldtneri-ttiaadtWiiiotetdtoart iiiatiatttntiallatuatioeitoaeliortraleiittaoipatniiotetimelatiettgraeilrtim oaelio,tiouataxiatditgtioeitparatt’atlifaftPrtgrematoevatbaattaaieblia melatitittioatotapiieltittviaiitioatilltetdtittturaitgtotmaatetdtraiira viaiitioataldarlr,tbritgitgtniiotioamtioaartetdtetaataattftnalltbaitgft itg,ttftelltioatetimelatdtmaaiiieiadtbrtoumetiir,tioatieitrameitatio dati,tiouatraquiritgtioatlaeaitemtutittftieraftiuiotetiraeiuratntuldt tftiotiiatftrtttatnottiataldarlrtetdtparoepatuteblatittiatdtittioat dametditgtiriiiarftNtn,tiftaiiatiatiatrigoitebtuitlifataxiataitttbaitg communicated messages between the Witch and Satan can be found here, in the
Liber ab Familia (Book of Familiars—Condens which we are part but which the Cerrch deappraaelysouglitOo separatel'som.Remem-ber, the Church State of the Burning Times taught that their God was supernatural communicated messages between the Witch and Satan can be fou familiar’s communication between anyone who would listen and the which we are part but which the Church desperately sought to separat ber, the Church State of the Burning Times taught that their God w and widely opposed the concepts of gods and goddesses that had dev alongside humanity. That Church opposed nature and the explanatio (science) and attempted to snuff it out at every turn. The discovery of the Earth is round and in orbit around the sun, was met with executi then lumped in with the Church State’s boogieman because their w from the Semitic word for adversary (sometimes incorrectly cited as tainly any creature that spoke to us of all things natural would be view (satanic) to their supernatural (“Of or relating to existence outside the God and the heavens in which he ruled.
In embracing animals and the natural world in which we belong, adversaries of any power structure that would think otherwise. When no, you may not pit dogs against each other for amusement and betting adversaries. When we say yes, we will punish you for organizing cockfi the adversaries of any power structure that would think otherwise. and times they are a-changing. Promoting such events is now illega civilized world. Yes, when the fight organizers are brought to court by exploring the mystery oBoue religion, wol'ind thaC tOoseYthicsmamfest meourae-tions and in our wardo
ol out socreiy’s gtoua coescrouseess. Tsrs rs wsete Wrcca aei telrgr eisrcs comes re. By coeiucireg outselves re accotiaece wris ise eisrcs by exalotreg ise mysiety ol out telrgroe, we lrei isai isose eisrcs ma iroes aei re out wotis.
Tsrek aboui isose lolk wso otgaerze iog lrgsis aei cock lrgsis. isert taeis cause lolk io become srckeeei. Mote aei mote, aeoale iut oli Csutcs Siaie siyle ol Cstrsiraeriy re irsgusi aei aetsaas mote rm aei mote Cstrsiraes ate acceaireg ise riea isai ise itaeslairoe ol ise wouli save beiiet beee ’siewatissra.’ I say mote rmaotiaeily because oee clarms isert telrgroe io be, eo maiiet wsai woti isey use ot wsai i ot triual, wsai maiiets rs wsai isert soul iells isem isai telrgroe rs aei beiweee csutcs ot triual. Lei’s lace ri, mosi ol us lrve re a Cstrsirae soc io so aeacelully. Bui ri rs rmaossrble io io so wris a Wrccae soul rl isa ues io subsctrbe io meireval rieas isai ise aermals exrsi lot ise amuse as isai ateiomreaeily Cstrsirae socreiy itaeslotms ris vrew oe aerm ltom ise aosriroe ol aivetsaty, we become less ’saiaerc,’ aei re isai i resitumeeial re beiietreg ise lrves eoi oely ol sumaeriy, bui ol all wso against our Lord and Lady. No, the battle for animal rights has not been won, but with
212 A Wiccan Bible
Before I begin a discussion of the Wiccan familiar, I must warn you that I am not talking about the fanciful stylish familiars or spirit animals that many folk lay claim to against our Lord and Lady. No, the battle for animal rights has not be continued inroads being made in a sensible manner, we are certainly
Before I begin a discussion of the Wiccan familiar, I must warn y talking about the fanciful stylish familiars or spirit animals that many for fashion sake. If you want to claim a critter is your familiar just to neat to talk about with your friends, please do just that. Claim, and cla ing an animal is a serious responsibility that should only be taken by t ted animal-lover.
Being involved with a familiar is a give and take relationship. Wh comes a critter into one’s heart, he or she welcomes that critter as fam not willing to give, please don’t take because without that willingnes your familiar, neither you nor your familiar will receive the benefits of You might think that without a pet your life is miserable, but that is no another critter’s life miserable.
The familiar is much more than simple companionship. It is a c world that we sometimes think lost when we moved into the cities. Prio revolution some 8,500 to 9000 years ago,3 humanity lived mostly as a ture. We fueled our migration up the coastal areas and tributaries, livi well as the hunt for both flesh and fruit. The Neolithic revolution when we turned our attention inland and began building permanent co Our familiars femineusmmtwe did notlebecthenatsirclworldad al I, tlfatelthei^lu our modern ways miglil. eeemaztifisfalomremovadfromnetueerthereremainy zeso ifiea deflaed ts natural tad artificial (mta mtde) ts lf humtaliy wele atiultl wslld.
Oul ftmllltls lemlad us ieti we dld asi letve iee atiultl wslld ti sul msdela wtys mlgei seem tlilflcltl sl lemsved flsm atiuler iee deglees sf septltilsa beiweea eumtaliy tad iee atiultl wslld. If w csaaecied is ieti atiultl wslldr we wsuld asi see exilacilsa tfiel ex leltilsaselp is iee tcilsas sf eumtaliy. If we dld asi etve iee tlls sulselves lais ielaklag we tle asi csaaecied we wsuld asi be sescke lze iee scspe sf iee desilucilsa.
Bison American—Femlalae Etlie
Also known as: Amellcta Bufftlsr Bufftlsr Blssa
God associations: Gleti Splllir Ttitakt
Goddess associations: Dulgt
manity saw to it that by the beginning of the 20th century their herd had been reduced
Welle ieele tle mtay talmtls ieti lllusiltie iee aeed fsl Wlccta celldlea sf Etlie tad Skyr few lemtla tllve is iell ieell sisly. Tee A slaughtered (most for neither meat nor hide). Today, they number approximately 30,000.
Liber ab Familia (Book of Familiars—Condens Also known as: African Elephant and Asian Elephant
slaughtered (most for neither meat nor hide). Today, they number appro ephant), Krishna, Kurma, Minos, Rhadamanthus, Shiva, Vishnu, Vulcan
Elephant—Femnne, Eart
Also known as: African Elephant and Asian Elephant
God associations: Aeacus, Apedemak, Bacchus, Dionysus, Ganesha, ephant), Krishna, Kurma, Minos, Rhadamanthus, Shiva, Vishnu,
Goddess associations: Artemis, Diana
and Desert elephants are all sub-species of the African elephant. The African elephant
Most people do not realize that there are two species common Elephant. These are the African and Asian elephant. The Indian, Sumatran elephants are all sub-species of the Asian elephant. The and Desert elephants are all sub-species of the African elephant. The entered the twentieth century with a speculative population of 5 to 1 time the twenty-first century rolled around, there were less than 600, rately, there were less than 600,000 when they were added to the end list in 1989. The Asian elephant is in worse condition, having started with even fewer numbers. At the turn of the twentieth century, appro 3A5si0a0n0Ealedpehcalinntes einxipstoepdu. lAattiothneotfuarbnoouftt8h2e.5twpeenrtcye-nfitr.st, there are no
Animal Kin and Animal Kith
Before you remodel your home Thlew Tn elephaatietodrf livrng roorn.know that farmliars come in two varieties: kith endkin.Justas tlieprocessof adoption can
Anomal Kon and Anomal Koth
cause that creature to go from kith to kin. Those creatures brought into both heart and
Before you remodel your home to allow an elephant into the liv that familiars come in two varieties: kith and kin. Just as the process change a human from kith to kin, so does the adoption of an animal ot cause that creature to go from kith to kin. Those creatures brought int home are said to be kin creatures or kin familiars. In Wicca, these crit known simply as familiars. However, one need not have an animal in t come it into the heart. Indeed, those creatures often reside in our he we recognize their residence. These creatures that are welcome in o whatever reason not in our home are said to be kith animals or kith fam these critters are most often known as power or totem animals.
Kith and kin familiars can be equally in our hearts, but just as relations of kith and kin there are distinctly different ways in which relationships. One might commune with the children of our friends (k their birthday and graduation parties. Be it by adoption or birth, a pe mune with their own children (kin) by bathing them, taking them for th Common sense: It is not appropriate to take a human child from a shopping center and
214 A Wiccan Bible
Respect for critters: It is not appropriate to take a baby bird from its mother s nest and bring it home to be your pet.
Common sense: It is not appropriate to take a human child from a sho raise it as your own.
Respect for critters: It is not appropriate to take a baby bird from its m bring it home to be your pet.
who have shed the spooky names that seem to come with the Wiccan religion substi-
Kin Familiars
critter in mixed company, many know exactly what that critter is and commune with
Most Wiccans have knowledge of the kin familiar and simply call it who have shed the spooky names that seem to come with the Wiccan tute the word friend for familiar. Although they might use the word pet critter in mixed company, many know exactly what that critter is and him or her every day. Others argue that the critter is not a familiar, de belief that the word familiar is only used to describe animals that have religious rituals. To those folk who believe the word familiar only be used in formal rituals, I have to point out that real life is vastly more ritual. Not wanting to be redundant, but wanting to address those who convinced of this, I ask that you please read Chapter 6 of my book W (New Page Books, 2001) to understand where I am coming from on t
If you have bonded with a specific animal, that creature is your fa actually matter if you have welcomed it into your home or given it a also like relationthons with-umaer, thetefsonlysomnghtimein i dsy.I havnobs scvod that my closest friendshipsare tharedwith peoptewno,isksl,do nothavea tiemsn-dous number of ciosefriends.
One need nodplece his nogLneir altasnndpsese himfoathaedoetspeniyfarmlier. Neither does oneneedtoeakeono’ssaw eoeiuwlrrreonpgo es or sncyhshs ecial jrwedey tIet -y cliieit creeneiIeei ere iIeree setI eeiele sIi, leke I, ei nit eidi nd-ber ic caiie creeneig
One neee nit eaece oei eig in oei eater ene baeii oe- cir toet eig t Neetoer eiei ine neee ti teke ine’i cet eierrsoere ine giei ir bdr e ti -erk eti renk ei ce-eaeerg Ooe toeie toengi -egot iee- cdne bdt icte cir toe e-die-ent ic toe isner toen toe bine betseen ine ene oei ir nit e oere cinceet ti dneeritenee ene ret eeieae ii-ete-ei iee- ci toei regereg
Ic rid sere ti eik e bere ciitee creene ec toer sent ti seak in o ecterniine toer sidae eribebar ier nig Yet eierr reer et idr aicea C iea3e I iee eizeni ic eig isneri seakeng toeer eigi in toe baecktiee et ti dneeritene sor toeer beaiiee eeti ere erecteceaar giiie-iteeeengg et idtg It sein’t toet toer eee nit cere ebidt toeer ene-eaie et sei bece ci--dnecete seto toe-g Uein toei reeaezetein I itertee etteneeng s familiar it is because we are not treating them as a familiar. We are not listening to
Liber ab Familia (Book of Familiars—Condens zation funded e huge public servicecampaigia thatman0 peopleaaalizad—eaviog adog in a car during the summer might be a bad thing.
familiar it is because we are not treating them as a familiar. We are what they have to say because they do not use words. It wasn’t until so zation funded a huge public service campaign that many people realiz in a car during the summer might be a bad thing.
Thus, shattering the more popular conception that a familiar is de that is involved in Wiccan ritual, the point at which our pet becomes that point where we begin listening to them. After all, that is the class familiar now isn’t it? Our familiars communicate on a level that is far stand than words. But one need not pry these messages from them wi tarot cards, or psychic reading. Their messages can be found in their tell you about my ferret friend Thumper, whose name she received fro makes when she has crawled into that space between the inner and electric oven. You know, the space between the outer and inner wall o is supposed to be filled with insulation to keep the heat in the oven tha bottom of the oven should you take your eyes off your ferret for a few
Always trying to get me into a foot race or a game of attack the t that when your needs are met, being playful is important to maintainin Just watching her tells me that when playfulness gets you into a tight sp get you out of it. Of course, she also warns that playfulness can be especially when she tries to play with Fred, my 4-foot iguana. She efits greatly fromwhatThiimpnrhastoldme.Yfoi sonOamnotwithsiLittemplatioo, and it does sometirodtseenodinflidn manemt odke mnd HuVit,too.But thurn’eToumpee’s wdrning thdt whdt migOWse um tOn noOOmgmo re thcnpldyeureunnodhrhurtsumounn iniulution, but I uT inuoludn in u TonoruToui but lonr niituncd rdluti e.ini rreunly .rom rsun Tsumper sui noln me. You iee, e um non rin unn in noei iomenimei ieem ui i. e cun suue my cuke unn eun in, noo. Bun n rurninr nsun rsun mirsn ieem like nonsinr more nsun pluy.ul .un mir nsun e loue. Sure, in noei ieem nsun u roll in nse suy rins u locul luii r romun no rsom e um irorn. e mirsn euen oe uole no runionulize nse myiel. inno oelieuinr in ii juin iex unn noein’n meun ull nsun mucs. iniulunion .rom my ouen. en’i juin iniulunion unn noein’n ucnuully meu inr nse .irin ierioui relunionisip e suue oeen inuoluen in iince suuinr n rins Tsumper, nse rorn ii inill oun on sor nsinri rill pun oun. Bun i iounn unuice.
Tsii orinri up iomensinr uery impornunn uooun nse unuice riuen oy o Euen more io nsun our sumun .rienni, crinneri no non liinen no nseir o nukinr in, one muin ulruyi no io .rom nse inunce o. liineninr no rsun n crinneri no non isure u common lunruure, io in eiience nsun rsics nse iuy. To nell me nsun pluy.ulneii mirsn oe miiinnerprenen, Tsumper sun nry no pluy rins Fren. To nell me nsun one isouln keep ponenniul surm .r
Finding Kin Familiars
Generally spelling, it is not lair to take an animal I'romtliBwild and bring it into your home. There are exceptions, but with each comes tremendous responsibility. Re
Finding Kin Familiars
give. I hope you will agree that deliberately kidnapping a critter and forcing it to live
Generally speaking, it is not fair to take an animal from the wild your home. There are exceptions, but with each comes tremendous re member that the Wiccan Rede specifically tells us that we should “fair give.” I hope you will agree that deliberately kidnapping a critter and by your side is far from fair. But what about injured wildlife? Certa loving home is superior to death in the wild.
Far be it for me to tell you that it is bad to assist an injured anima count the number of animals I have brought into my home this way. If y me, ask my mother who probably cannot count the ones I brought into I was a child. But in making such a decision for a young critter, reme creature should imprint upon you or not learn that which its parent about survival, there may be no way to return it to the wild.
Another way kin familiars come from the wild is by the actions Should you take a critter’s guardian before its young are able to fend the just hunter is charged with the life of those children. Rather than eye to the suffering and starvation that taking a guardian will cause to hunter will, at a very minimum, swiftly end the life of those children, f ate home for them, or adopt those children as one’s own and raise th life that one took. Incidentally, this has also been general policy of ma kindness.
As with huntifg,heouisaolfce whereThelieoeIfeel veryoifferentiytpan many seem like the kindest way to bring an animal into your life, it is only as vastly more fairihanehr meahmdustrhrhaisnry liesmotkgroceiattorer.Thbdiffeor kirdreeee
Ae wirh hirrirg, hnan ie c rlcsn whnan I bnlinvn I fnnl vnay eiffna purchases flesh from moirgroectyttoree,nne can nevecbusnceiSihr taking of thetliie cetvcerlyteoantfciatrhcrtrhntencrtireieraytrhcrteirrlineteoertgaosnayter nrsntietrhcrtwhnrtorntrcknetrhntlifntoftcrtcriecl,trhnthirrnatwirrneene ctvinwroirrtwhnantorntscrtensientiftrhntcsriortoftrckirntrhcrtlifntwce riashcenetflnehtfaoeteoertnaosnayteroane,torntscrtrnvnatinteiantiftrhntr wcetfciaetArtrhntaiektoftclinrcrirntrhntnancrtecjoairytofteytancenae,tItia cllowtyoiaenlftroteckntcrtneiscrnetensieioretBnfoantcncirtncrirntfln vienotoftrhntenrhoeetienetrotacientcretkilltrhntcriecletrhcrtfnnetrhnt eroanetRnclizntrhcrtirtriashceirntrhcrtraoeisrtyoitcanteirroarirntrho rhnrtcektyoiaenlftifteoirnteotietlivirntirtcssoaecrsntwirhtrhntoisscrt “fcialytrckntcretfcialytnivne”tItcetrortrnllirntyoitrotioysorrtnaosnayt cekirntrhcrtyoiatcsrioretintrcknrteirefillye
ohnrtfireirntsairrnaetrotinsoentyoiatfceilica,tItcektrhcrtyoiteotrh the argument that the animals that are already in the pet stores need homes, but the
Liber ab Familia (Book of Familiars—Condens and will find e home without your ersistance. lam notOollingyoiito boycott pet ntoens, I am just asking that your actions be taken mindfully.
the argument that the animals that are already in the pet stores need counter to that argument is obvious. If they are in a pet store, it is beca and will find a home without your assistance. I am not telling you to bo I am just asking that your actions be taken mindfully.
Although there is clearly a difference between kin familiars and choosing one’s kin familiars, one should remain loyal to the whole of it proper match. This is much in the same order as human adoption. Ho see how a card-carrying member of the Ku Klux Klan might not be th adopt an African American child even if s/he honestly loves that child look at the history of slavery to know that when souls are sold mainly sales are indiscriminant. While there is a difference between the way about the sale of human life and the sale of critters, the principle re The result is that generally speaking, pet stores buy and sell their pr slave trade, indiscriminately.
So what does happen to the critters that pet stores do not manage them wind up further burdening one of the best kept secrets in the critter rescue services. With so many Wiccans demanding secrets be thors, I am surprised this one has not yet been printed. If you can thi you can probably find that animal at little or no cost in the care of many As an example, a recent visit to a pet store to purchase some canned Igu
“MOOAFAhO iscnon foopwofituhgsnizaitonwhtch raOesin uotcaoUem, dhsoO, aadrohmtSd pote,ssassbibOatasihdo,aodfisdstifmn rawfssrw&'tohmes. We take in strays, owner surrenders, and some with health problems. We rehabilitate when necessary, vaccinate, and put them up for adoption after recovery
“MOSAFARI is a not for profit organization which takes in unwant and neglected pets, rehabilitates them, and finds them new forever take in strays, owner surrenders, and some with health problems. tate when necessary, vaccinate, and put them up for adoption af from illnesses.”
—From the MOSAFA oiip://www.poifinsor.org/hooliorh/OH48.oiml Janua
Note: This URL will soon change to www.m help battle the hordes of unscrupulous breeders. By dealing with a reputable breeder, Oftcourho,thomotfolktmigoitwanitiotasopitonlytooalioytbabytcriiior ioaitihtiootcaho,tfinsingtcriiiorhteiatiootmanytrohcuothoreicohtihtatgoos hoo,tmohitrohcuothoreicohtroalizotioaitsomanstanstnoiworktwiiotropui oolptbaiilotiootoorsohtoftunhcrupulouhtbroosorh.tBytsoalingtwiiotatro youtwilltgonorallytpaytonlythligoilytlohhtioantpoithiorotpricoh,tbuityout eaniagotoftknowingtyoutoaeotromainostiruotiotiootlinotoftyourtnowtcr store fixtures, and let’s not forget the rent, they simply cannot afford to pay breeders
218 A Wiccan Bible
1. ’For profit’ breeders—If their primary intent is profit, they cut corners to store fixtures and let’s not forget the rent they simply cannot afford top dollar. As a result remaining in business requires breeders to do o low children to leave their parents too early, and decrease the amount of
1. ’For profit’ breeders—If their primary intent is profit, they cu lower their selling price. In so doing, they overpopulate living crease the genetic distance between mother and father (inbr low children to leave their parents too early, and decrease the human attention each critter receives. The result, like almost a at economizing a product, is a product that is inferior to other production.
2. ’For love’ breeders—If their primary intent is focused more o for the animal they raise, they will refuse to cut corners to d selling price. In so doing, they allow critters to have approp areas, increase the genetic distance between mother and fathe ing inbreeding), insure that children are fully weaned befor increase the amount of human attention each critter receives. it ae hmigohsercopriacgee anlthuosurgyh, tshatapraicseupreermoarinpsrocoumcpasrapbrloe buec service. Rescue the critters yourself, allowing destiny, karma, Wyrd, or whatever you oonpeerateiangs awpet astorree.eereyemnaeemanyexpenses sciousness, critters are in no way stupid. The absolute best dog I have ever had still lives
But there is still a source of critters that is superior to even the b loving and joyful enimel I hsccevaehrdths fortune oCepeooataeing.Why? Be causel want to call it to bring them into your life. Although they do not pos his life is all the bctterfosit.
Puppy (named aftee aroemmate by toe famenameS andf lirft.met.diiringt.lK’ lnit.g a.d jnfftl a.tmal I haie eier had the fnrtt.e nf e.cnt.tert.gl rescted ate frne m etsermbre stmte m.d mfter m femr nf rnit.g cmree ae ats rtfe ts mrr tae better fnr ttl
Ptppf (.meed mfter m rnneemte bf tae smee .mee) m.d I ftrst .tgat nf m cnrd rmt.stnrel I cms drtit.g bmck frne emcat.mtt.g mt m sntta cae. I fnt.d ate t. tae etddre nf tae rnmdl At ftrst I tantgat cmtse an.kt.g snrtctted .n respn.sel I pmrked ef trtck brnckt.g tae tae amzmrds tn cmr. nff ntaer trmfftcl Upn. mpprnmcat.g atee I dtscni t.deed mrtie btt treebrt.g t. femr ms cntrd be m.f brt.de demfe m.d pm the human society fot adoption, ttey wonldeertainly pulOimdowmbecru sn ha wes ini-adoptable. Well, someonamissed aefbecaiisealthofiphlieisiiotfoogood atplaeing catch, fetch, or acythingthat involooceywfiySS|ho-fakШer atploymgfagnf wacwith socks. Sure, it’s usual lyihesscks fdat it liaven’tdopatecitnfhateairsp। Pud g.e.lt’sjairf has way of telling mete uicgsioaftr emyteif.
Cat (named after my lawyer at the time) came into my life much as did Puppy. I was
Liber ab Familia (Book of Familiars—Condens with friends. After my visit, I was er my way tomy caowheols^ttedrer inonoenr-grown grass field next to my car. She was dehydrated and seemed a bit lame, but I
Cat (named after my lawyer at the time) came into my life much as returning from visiting my lawyer Catherine when I stopped in Lancas with friends. After my visit, I was on my way to my car when I spotte grown grass field next to my car. She was dehydrated and seemed a didn’t think she was really in need of rescue. She insisted. Now I don’t m up her mouth and talked to me, but she looked at me with those big l told her,“No, you might belong to someone, so I am not going to fal really want to come home with me, you jump in that car yourself.” Alt boastful, she did just that. Yes, I did hold the car door open when I took it upon herself to jump into my car and my life. Ten years later, sh by her own choice. How do I know? The store door is propped open w and she remains inside because she knows who loves her.
Neither Puppy nor Cat participates in formal ritual with me, bu certainly part of my religion. They each speak to me of loyalty and of h that choose to love me. During the time I have had them in my life, I occasions to be down and out, doubting very much that I will ever fi end of each tormented relationship. Each time Cat would sit in my lap his cute little howling noise, both reminding me that I am loved in lov don’t know about you, but that message has surely extended my life.
power animals. Folk following the rediscovery of Native American ways sometimes call ther" spiril animal. orFOm. animals. Those who have discovered the Dream Time traditions of South America and Australia sometimes call them dream animals. Folk
Folk who identify with the term New Age (and a few Pagans) te power animals. Folk following the rediscovery of Native American way them spirit animals or totem animals. Those who have discovered t traditions of South America and Australia sometimes call them drea who follow specific pantheons of gods and goddesses with specific ani call them by the name of that god or goddess. Such is the case with (Hawk) and Bast (Cat), each having their god or goddess name even w purely animal form.
In formal conversation, I call them kith familiars, but mostly I ju door critters. These are the animals that we do not know on a person their entire line as if it were one. When we talk about these critters, their collective name to honor their collective spirit. With this relatio are called Wolf; all hawks are called Hawk. The order in which we critters is much the same way we relate to groups of people. Although rate than the description of a specific person, this practice allows us t eralized expression of common observations—a fancy way of saying s
Now, before you experience a knee jerk reaction to the use of ste mean that all humans believe the Earth is round. When we acknowledge the existence
220 A Wiccan Bible
This is one of the many reasons that when we are speaking about kith familiars, power animals, totems, or whatever we choose to call them, we are talking of the order mean that all humans believe the Earth is round. When we acknowled of stereotypes, we can discuss a matter in that order.
This is one of the many reasons that when we are speaking abou power animals, totems, or whatever we choose to call them, we are tal of their entire line and not any one individually. This normal process of I can make observations about the human race, such as males have gre strength than females, without the expectation that I will widely be see that I did not say males generally has greater upper body strength than I was speaking of the entire line of humanity, a group in which the male does, indeed, have more upper body strength than the collective
Even if one develops a personal relationship with kith familiars, th with the whole of the line if it is in the order of kith familiars or it is ter This is important because the guide that follows speaks more the whole critter. Forexample, Bear being listed as having feminine attributes m the attributes of most bears seem to be feminine. It does not mean tha where are females or even that all bears in every situation will be fierc their children. Instead, considering bears to be feminine in nature m were to take the sum total of all bears everywhere it would be a safe b and Papa Bear are in the area, you don’t want to mess with Baby Bea
This principle can provide great comfort when considering the f trying to escape, theteamwe bee Rabbi t continuinetofeed on graeni,Foxcontmuingto feed on Rabbit, end the death ofneietereventeoeehmdividual ereatureado die. We recgitize ehae alehguih Fgx dgec itdeed kill Rabbie, ie dgec tge make allgtc uc eg recgitize ehae alehguih Fgx muce eae Raeeie eg live, Rae eryiti eg eccapei Itceead te cee Raeeie cgteituiti eg feed gt ireetc, F feed gt Raeeie, atd ehe deaeh gf teieher evet ehguih itdividual creae cee ehe Cycle gf Bireh, Life, atd Deaeh repeaeed aiait atd aiait it ehe cgmeeimec ceemitily myceeriguc tayc gf taeurei Bue ehe mgmete t crieeerc ac itdividualc, te mgve eg prgeece raeeie frgm fgx, ehuc caucit fgx ey cearvaeigt atd ehe cufferiti gf raeeie frgm gver pgpulaeigti
Alehguih ie hac eeet pgpular eg litk cpirieual relaeigtchipc tieh at eg Naeive Americatc, vireually all reliiigtc have chared a deep cgtt malci Cave paiteitic atd primieive carvitic ehae celeeraeed atimal fgutd eg ee gf at griiit ehgucatdc gf yearc eefgre humatiey ever ehgu Ngreh Americai Rememeer, ehere ict’e really aty cuch ehiti ac a Naeiv are all Africatc, cg te all erguihe tge gtly ehe ietec eue alcg ehe cu ietec eetd eg prgmgee thet placed it cimilar etvirgtmeteci
Prehicegric Shamat frgm acrgcc ehe tgrld drecced, aceed, atd da bears bringing treestothe gtohnd, lheycaiied vn BaartnrsteengthaeainєієііогієгоП foe. When they saw the well-functioning communities created by Beaver, they called
Liber ab Familia (Book of Familiars—Condens nities. Although the practice may seeaeither overl(mysticalorevena bis silly tosome urban folk, it can easily be seen as nothing more than asking your neighbor to help you foe. When they saw the well-functioning communities created by Be on Beaver for the order and wisdom to create and maintain well-func nities. Although the practice may seem either overly mystical or even a urban folk, it can easily be seen as nothing more than asking your neig with a skill that you are lacking. If it feels a bit silly to you, think abou
Overnight one of the tires on your car goes flat. You have never c your life, so you go next door and ask your neighbor, the mechanic, if s/ how. Of course if its a hot day and you know your neighbor likes B might want to mention that you have some when you ask. For larger f want to find out what type of pizza he likes and offer to have one ready that strange that I make a short journey several times each Spring an a favor of Duck? Or that I often bring him treats? After all, it wasn’t u that our critter friends were not our next-door neighbor.
You might have noticed I just personified Duck in the masculine. notice the attributes for Duck are feminine. This is because although guidelines for the gender associations made with animals, those gen change with our involvement with the critters. Gender is a very person is exactly the order of relationship we experience when we allow our hea by kith familiars. So let me tell you the story of Duck in the hopes tha stand my experience with kith familiar and use such critters to greatly away from humanityjfws.yforsfewhourr.hXftwrhiHngelowbtothestioamfed bytlw waterfall, I spied Mama Dnckandher five chicki walkmg towards the creek. I became completely still, hopingshe wouldnokneticemfik thinksheCidgutdecidedtatakek chance. Her and hcrchickTheSeaedahastseamcn fit. asteC twlmmingtowsadsthsfell s. I entered the strahmanCColloman аІІсгіГіУПі
The shallow wateewa.sflcwmMktconDluenosdhthaie fibred ik wnul dwover tlie ntalieleiy fliii, htlirg fhe tttil rtl rtline ae. i lhirk fhe lil btl l nhkrnt. Hts krl hts nhinrf trltstl lht flstka krl flksltl ftiaairg l i trltstl lht flstka krl ntiitttl knlts lhta.
Tht fhkiitt tklts tkf nittirg flstrgiy trttgh lhkl i nigtstl il threat was present.SVeanCncrchicks oped uhandlhevdisappccredscmewheeeCce i hklr’l nttrltl tr tkf lhkl thtr i fltlltl irlt lht flstka, i likntl completely invisible.
ecclfltlf; fht Sttltl cSim lc htks Pklk ltnr’f tksSiSgf lc rSct lhkl lhstkl tkf lstftSl. Sht kSl hts nhinrf fltl tl kSl lhtS lifklltkst khtkl ce am lcfilicS, kilhctgh i lsitl lc eiSl lhta kgkiS il tkf kf ie l ncalitltim iSvifibit.
Tht Stxl lkm i stltsStl tilh k nkatsk kSl ltitlhclc itSf. Thk liflkSnt btl rStt lhkl Pklk ltnr tkf kgkiS tklnhiSg esca kbcvt. W time he relaxed and went about his normal routine of escorting his family to the water-
222 A Wiccan Bible
I hadn t dressed like a duck, walked like a duck, or quacked like a duck, but I had heard Duck speak even more clearly than some of the married men that I know. He time he relaxed and went about his normal routine of escorting his fam fall and then back down the stream into the river that it feeds.
I hadn’t dressed like a duck, walked like a duck, or quacked like a heard Duck speak even more clearly than some of the married men said,“This is my wife and family. There is nothing else that is as impor
Note the period at the end of what Duck said. One of the reason easily communicate their message is because their message is simple the way one might call a person of low intellect, but simple in an unclu say what they mean and mean what they say, period. Humans seem saying that no sometimes means yes and wet sometimes means dry. A the movie Gone with the Wind and they will probably tell you how roma Ret whisked Scarlet off her feet, up the stairs, and into their bed. As you are likely to be told it was rape. You see without the clutter that fi means no.
Animals also speak to us of purity in duty. Many Wiccans reject Al law of Thelema, which reads “Do as thou wilt shall be the whole of t they do not understand the nature of what Aleister Crowley called “wil to Far East, this principle is called “duty” or “dharma.” It is that which Animals remind us of this purity. When Fox kills Rabbit, the action is are no karmic reactions in the order of punishment because the act we kill is also sacTTd,thus shoald hWiagan findctnecessafotokilltheor sUeinsiststhht the death be as palnlesk as uassibte.
latursiofithsiiagaligodiofithsihultinstlgithatiwhtchitsihultsd,ithsisac eseustiofithteiwayiofithtlktlg,iwsiessithatiasthoughidsathiteilscseeaeyifo wsiktssiteiaseoieacesd,ithueiehousdiaiWtccaliftldittilscseeaeyitoiktss,ihsio thsidsathinsiaeifatlsseeiaeifoeetnss.
AsthoughiIiasiaivsgstaetal,iIiklowithatisalyiofisyiesadseeiaesi thatithsesiktthifaststaeeiaesiaseoithsialtsaseieatesdioeihultsdifoeifood.i eouecsiofifooditoinsialythtlgiehoetiofieacesditeiaigesatistetaks.iNotiol thsianuesiofithsifoodieouecs,ittissadeitoiaieftettuasttyithatiteidsfetvs aefscteiaeiwsss.iButitlitaktlgialtsaseifoeifood,ithsyisuetiessatliktthifa ktl.iThsesiteiaicuetosiasolgisalyiwhoieatesistvsetockithatiolsidoseil tfithatialtsasihaeinssligtvsliailass.iThatieassicuetositeiastvsialdiws hult.iShousdithsyinsfetsldiaidsseialdigtvsittiailass,ithsihulttlgiof ststte.iWhsliaijuetihultseitakseidsseifoeifood,ithatihultseitakseis Whsliaijuetifaesseitakseiaiftgifoeifood,ithatifaesseitakseiitg,iloti thatidtetalcsicssaeiteiwhatiassoweihusalttyitoicolductittessfiaeijuetife whoitakseiRanntt,iwhsliwsifsefoesiaijuetiktsstlgifoeiaijuetiesaeolieu dsathiteijuet.
years earlier. The other old timers believed his fish story but the young pups challenged him:
Liber ab Familia (Book of Familiars—Condens “So where’s the proof if you caught him?”
years earlier. The other old timers believed his fish story but the young him:
“So where’s the proof if you caught him?”
“Out there in the pond. I put him back,” the old timer told us.
“Why?” asked the younger fishermen.
“Because the pond just wouldn’t be the same without him.” caught in a net and not on a line, the find didn t draw much attention, no pictures or
Well, old Walt was finally caught in a net. The property the pond chased at auction. The new owner decided to harvest the pond and stock off as farm raised, then restart the process by stocking the pond. caught in a net and not on a line, the find didn’t draw much attentio documentation in the local fishing journals, but there was a picture u board at the local gun and rod shop—up for about a week, that is. Th that gun and rod shop took the picture down, leaving pictures of oth been up for years. Why? Because the owner knew Walt too, so leavin just didn’t seem right.
I loved those old hicks because they had instinctively tapped into th familiar and even gone so far as to fall into the same trap that has cause many Wiccans. They allowed a kith familiar to become kin familiar. A owner was proud of his catch, no one would display it. Although he
wa
Finding Kith Famiharg
I have been Pagan for the great majority of my life. I was introduced to the movement years before I could so much as drive a car. But the last ten years of that life has
Finding Kith Familiars
experience. I own and work in a Pagan shop, live in a Pagan household, and as a result
IghavigbiiggPagaggfrjgthiggjiatgmahrjitygrfgmyglifi.gIgwatgigtjrduc migtgyiajtgbifrjigIgcruldgtrgmuchgatgdjivigagcaj.gButgthiglattgtiggyiaj biiggtpigtgcrmplitilygagdgtrtallygimijgidgiggthigcultujigiggagwaygthat ixpijiigci.gIgrwggagdgwrjkgiggagPagaggthrp,glivigiggagPagagghrutihrl rfgmygcajiijgatgaggauthrj,gmygattigdagcigrfgPagaggfugctirgtghatgjitig lattgtiggyiajt.gSrgpliatigdrggrtgbigrffigdidgwhiggIgtillgyrugthatgiggrbt crmmugitiitgutigrfgkithgfamiliajt/SpijitgagimaltgIghavighadgmagygrc hyttijically.gItgtiimtgthitigtacjidgcjittijtgajigfrugdgmrttlygiggbrrktgag hadgmagygagcrgvijtatirggwithgfrlkgwhrghavigrglygtiiggthiijgtrtimgigg
WhiligIghaviggrthigggagaigttgfrlkgwhrgajigblittidgwithgtuchgagvit grtgbiliivigthigvitirggwatgvalidgifgthiyghavigmadiggrgjialgiffrjtgatgm tujigiggthigflith.gUglittgyrujgkithgfamiliajgitgaggixrtic,gmiitigggthatgcji
Of course, going outside of the city will help greatly. Deer hunting with a camera is
224 A Wiccan Bible
surprise, I have even met Fox, Lynx, and several oAlwwsccmi ugly uncommon critters simply by finding a mostly human free area and walking around. The larger state and
Of course, going outside of the city will help greatly. Deer hunting a great way to meet Deer and the many other animals that reside in y surprise, I have even met Fox, Lynx, and several other seemingly un simply by finding a mostly human free area and walking around. The national parks are great for this introduction. Even if you do not meet iar on the first visit, if you do your research well enough to identify hi just spending time in that habitat will greatly increase your connection your first visit, you might not spot your familiar but you will feel as if because that visit commonly involves a meeting, but your kith famili know that s/he saw you.
But your kith familiar is an exotic, you say. Where do you go to me every major city has a zoo and while it is not the ideal place to meet on it is certainly more affordable and safer than traveling to the natural critters. There was a time in which I would never advise patronizing those days, the zoo was similar to the “for profit breeders” I spoke o kin familiars. But those days are mostly behind us. Most modern zo some of the kindest loving people you will ever meet. Ok, some of them after years of dealing with that portion of the public that still shops a when they get to know you for the animal loving soul that you are, the There is little difference between communing with kith and kin familiars other than the level at which that communion can take place. We commune with both types of familiar with mind, body, and soul. Uhe nhnngctiotih ік the оraerof ournntire being or it is not termed familiar.
than theerelevsel attt ewhichetrheantcceomemtwueneinoncocamnmtauknenpglawcet. Wet coamnmunne of familiar with mind body and soul. The connection is in the order of or it is not termed familiar.
you can. Be able to talk about your familiar on an educated level. If one of your kith Mind—Reading about an animal does not make it a familiar, but it doe the connection. Volumes of books are often written on each. Becau are academic, you can find them at your public or school library. you can. Be able to talk about your familiar on an educated level. If familiars is an exotic like Tiger, know how many different types of If one of your kin familiars is a domestic like a dog, know what familiar is. In both cases, know what their ideal food is, how fast th high they can jump, where their genes came from. Your dog might who created his breed and for what purpose? If he is a mutt, know is, who bred the dogs that led to each portion of the mix and why. at the zoo, but where did tigers live before they were kept in zoos? in their native habitat? Most importantly, do they need your hel
Body—In terms of kin familiar, we can make body connections by playing with our
Liber ab Familia (Book of Familiars—Condens kith familiars, visit them. If theyare an exotica goto the ooo.If theysre won,goto the woods. If your kith familiar is Dog, go to the pound. Know that whenever your
Body—In terms of kin familiar, we can make body connections by critters. Dogs love to play tug and ferrets love to play attack the to kith familiars, visit them. If they are an exotic, go to the zoo. If the the woods. If your kith familiar is Dog, go to the pound. Know tha kin familiar is of a line, that line tends to become kith familiar as we if your kin familiar is a dog, then Dog is probably one of your kith But don’t fall into the trap of thinking that connections of the a pleasant thing. If you have chosen Dog (or if Dog has chosen y donate your time to your local pound. If you have been adopted donate your time to a ferret rescue service. This might mean shove in so doing you will receive the rewards of communion. While the ters on your hand, there will also be love in your heart.
realm of kin familiar without actually bringing an exotic into your home. Most zoos Spirit—In this world where we connect money to material things, we leasing money is in the order of spirit. Support your kith and kin f also be a viable way of bringing an exotic from the status of kith realm of kin familiar without actually bringing an exotic into your h have adoption programs where you can pay either the total or eve critter’s upkeep. Use the connections you made with your mind, y the critter’s state, to fuel the spirit of protest and public outreach. one out of three, such connections do not denote the personal level at which the word familiar is used. It is kinVof lide bemgmgore.Snrelyweheveallu ned thatterm long
it your familiar. This is because the order in which we use the word fa conngceron of mrnd, body, lnd soul. Wirlg ewo oue of eirgg rs noe l bl ong oue of eirgg, suci conngcerons do noe dgnoeg eig pgrsonll lgvgl le flmrlrlr rs usgd. Ie rs krnd of lrkg bgrng rn lovg. Surgly wg ilvg lll usg bgforg wg kngw wile re mglne, bue wign wg rgllly frnd oursglvgs rn lov re rs wrei our mrnd, body, lnd soul. Unforeunlegly, eile conngceron do cleg wgll rn words. Wign you mgge ong of your flmrlrlrs, bg re krei or k re wrei your mrnd, body, lnd soul. Cilncgs lrg eile conngceron won’e b nrclegd eo oeigr pgoplg, bue wile eig igll? Ae lglse you wrll undgrsel womln le eig gnd of eig block. Tile, lnd for wilegvgr vllug re ils, I eig morg for re. Afegr lll, us lnrmll lovgrs ilvg eo serck eoggeigr.
Noeg: Tirs condgnsgd vgrsron of Lrbgr lb Flmrlrlrs ils bggn sio consrdgrlerons. I iopg eo prgsgne eig rgmovgd mlegrrll sgplrlegly suc cln fulfrll res rnegne ls seudy mlegrrll for eig sgcond dggrgg.
who was worried about how horrible I would feel after
Chapter Dedication
making the attempt. And to Thumper and Fred, my close friends,
Tirs cilpegr rs dgdrclegd eo my lovrng moeigr,

Section
Sec
HREE
In Apprehension How Like as Crone and Sage
Section Introduction
This is the third of the three-fold pathol'Wicca.
Section Introduction
operating, it has become a living, growing thing with thousands of members who inter-This is the third of the three-fold path of Wicca.
gives me an opportunity to bounce ideas off people long before a book goes to press. A One of the things I am blessed with is my Website. In the years operating, it has become a living, growing thing with thousands of me act and participate in open debates frequently. I say I am blessed wit gives me an opportunity to bounce ideas off people long before a book lot of my ideas promote a knee jerk reaction, so by finding out what about an idea, I either find out I was having an off day or I find the m idea that I have not addressed. Now that we have polls running, th where it will end.
One of those many ideas I posted was that maybe Wicca should a set of ethics. The idea met a great amount of argument. Dogma, I wa step in totalitarianism and we know what happens when we go that question was that if Wicca does not have a set of ethics or any dogma religion if words have meaning? That is, if Wicca can be anything a p be, how does calling it Wicca (or anything in particular) make any sen ingly similar answers flooded in: Each Wiccan decides for his or her se and we do not need a standard of ethics or a dictate of dogma.
Wicca what it is. For someoeason,tStt folk drmwnm tothehemysteries tenAtocomoup with the same genotalbetieSSifn thiscaou ido oohthink it ita rtreSsh tosayWiccarih firmly stand agaiaotths moieshsStonanduanhothSitldren. Ihia mytin- thnt,t hausda-eta, aou ,tStrmeht lhlS ressl ea lh, ea hoSn Thtat lrt Sht mlha S

Liber ab Gens
(Book of Tribe)

wanted to include information on the Wiccan community, but I should tell you that this has been the hardest chapter to write. On one hand, I wanted to praise the many tremendously beautiful folk I have met on my Path. I wanted to share with my reader how beautiful what I found has been. On the other hand, I wanted to just scream that there is no Wiccan community. If I am to fail in accurately presenting my view of the Wiccan religion, this
chapter is going to be where I do just that. You see, more than anything else in the Wiccan religion, it is our community that simply must be experienced to understand. Unfortunately, that community is not something one can define. Fortunately, it is one of those things that a person is absolutely sure of once one has found it. Your folk are your folk. In a way, finding one’s tribe is akin to falling in love.
I believe that, like falling in love, community is one of the things that has allowed the human race to continue for as long as it has. We do not run very fast, we don’t jump very high, we have no natural camouflage, and when pitted against many of the other creatures of this world, we don’t fair well. Our only real strength is that we are driven to build community, to connect with like-minded folk for the betterment of both tribe and individual.
СЛОі
This importance of building community is a part of each and every Wiccan ritual. Yes, this step in ritual is often the symbolic sex of the Great Rite that marks union of two people along with the union of their families; however, the message is union of all kinds. And yet, with each and every Wiccan ritual pointing out the importance of building community, there is no central mailing list, no way to fully identify our tribe. You see, in all of our drive to unite in our commonalties, the very structure of Wicca demands that each person be an individual. As a result, there are great numbers of folk that have missed the point entirely. Even if a central community or mailing list existed, it would not accurately reflect the community to whom I write because as we have learned oh so many times, anyone can join a mailing list. In other words, if you have not heard it yet, you will surely hear someone call himself or herself Wiccan, and yet they have absolutely nothing in common with yourself. Now what kind of community would that be?
They might even perform the rituals perfectly, having memorized them from one book or the other. But if those rituals are performed without meaning, they do not make one Wiccan in anything except name’s sake. What we do in ritual does not a community make. Instead, it is those things done outside of the formalities of ritual that makes for a community of like-minded folk. This is true of all religious communities.
During Catholic ceremonies, there is often a time to turn to your neighbor shake his or her hand and say ’Peace be with you.’ But the action that makes community is not shaking your neighbor’s hand in church, it is mowing his lawn when his leg is broken, watching his house when he is away, and being concerned about his or her children as if they were members of one’s own family. One can define the Jewish community better by what takes place between visits to synagogue than what takes place in synagogue. One can define Christian community better by what takes place between visits to church than what takes place in church; one can define Krishna community better by what takes place between visits to the ashram than what takes place in the ashram; one can define Muslim community better by what takes place between visits to the mosque than what takes place in the mosque. So naturally one can define Wiccan community better by what takes place between our rituals than what takes place within rituals. In this manner, we see that what takes place outside synagogue, church, ashram, mosque, and ritual are infinitely more important than what takes place within those houses of worship.
The reality of Wicca is that there are two distinctly different types of people who call themselves Wiccan; thus, there are two distinctly different tribes. First, there are the folk who think Wicca is a soulful Path of duty in service to and kinship with our Lord and Lady. Then there are the folk who think Wicca is a reason to be all dark and spooky. Indeed, this split in Wicca has caused many to stop using the name Wicca to describe their religion in an attempt not to be identified with the faddists using the same word. Let’s face it, tell people that you are Wiccan and the TV show Buffy the Vampire Slayer will come to some folk’s minds. Others, like myself, have clung desperately to the word because we see the many noble battles fought to bring our religion into the position where it enjoys the same legally protected freedoms that other world religions do. We know that brave folk like Dr. Leo Martello and Herman Slater fought for these rights and we simply will not ignore their great effort on our behalf. We also know that while Pop-Wicca, McWicca, or WWR (Wicca Without Rules) continues to be a growing trend, the word that describes our religious Path has received meaning. While that meaning might not be set in stone word for word, it is certainly enough to define enough commonalties to call us a tribe.
On Dogma and Doctrine
The dogmas of the quiet past are inadequate to the stormy present.
—Abraham Lincoln
Before we can even begin to talk about finding community, we have to establish what that community is based on, what we have in common, because that is what community is. You might have noticed the words are even very similar in appearance. Indeed, they share the same linguistic root. So what do we have in common?
One Sunday I visited a Catholic and a Protestant church in an effort to discover the differences between the two. Of those differences, I observed that the greatest were that Catholics hold mass and Protestants hold services. A priest leads Catholic mass and a minister leads Protestant services. Catholic mass centers on an altar where a crucifix is displayed and Protestant services center on a table where a cross is displayed. So then, this must be why so many have lost their lives in the wars between Catholic and Protestant.
Catholic priests conduct Mass centered on an altar with a crucifix on it.
Protestant ministers conduct services centered on a table with a cross on it.
Is it really something worth fighting over? Most Pagans would say no. However, in their desperate attempt to avoid repeating the mistakes of other religions, they are very quick to fight over that of which we discuss here, dogma and doctrine.
The Dogma of No Dogma
The American Heritage Dictionary of the English Language offers three definitions for the word dogma. The first two definitions seem responsible for the bad reputation this very friendly word has received over the years.
· 1. A doctrine or corpus of doctrines relating to matters such as morality and faith, set forth in an authoritative manner by a church.
· 2. An authoritative principle, belief, or statement of ideas or opinion, especially one considered to be absolutely true. See Synonyms as doctrine.
· 3. A principle of belief or a group of them: “The dogmas of the quiet past are inadequate to the stormy present” (Abraham Lincoln).
But in running away from the “authoritative manner” of the church in definition one and the idea that anything can be “considered to be absolutely true” in definition two, shall we throw away the principles and beliefs spoken in definition three? What would our religion be without principles and beliefs? Would it be a religion at all if we had no principles and beliefs?
This does not mean that a person who does not subscribe to Wiccan dogma is of less value than one who does subscribe to Wiccan dogma. Of my love, no less worthy is my mother for being Catholic than would she if she were Wiccan. It just means that Wicca does in fact have principles and beliefs, but doesn’t say that too loudly if you don’t want an argument. You see, there are scores of Wiccans who insist that the Wiccan religions have no dogma.
The Doctrine of No Doctrine
Equally offensive to the ears of many kind Pagan folk is the word doctrine. Perhaps more so, the word indoctrination. Oh, we don’t seem to mind the words teaching or student, but indoctrination seems to reek of the notion that one is being brainwashed. Indeed this battle of words continues in the Pagan community, yet it is exactly the same argument as the Catholics and their altar and the Protestants and their table. You see, these are simply words that mostly describe the same thing. While they most certainly have meaning, that meaning expresses the ideas of what a thing is, not what is right or wrong.
One of the definitions available for doctrine is “A rule or principle of law, especially when established by precedent.” With all our talk of Wicca being a nature-based religion, one might think we would be more comfortable with accepting the law of nature. With all of our talk of Wicca being based on ancient fertility religions, that we might be especially comfortable with that law when established by the precedent of those ancient fertility religions. Wow, we do have doctrine. Is it so baneful that we would want to teach that doctrine to those who seek it? To indoctrinate them to the ways of Wiccan dogma? What would our religion be without this principle of law? Would it be a religion at all if we had no law?
Of course, this does not mean that a person who does not accept Wiccan doctrine is of less value than one who does accept Wiccan doctrine. Of my love, no less worthy is my mother not having formally accepted the law that Wicca insist be accepted.
The Religion of No Religion
Congress shall make no law respecting an establishment of religion...
—The first 10 words of the First Amendment to the
Constitution of the United States of America
How could it be that a person who believes in neither dogma nor doctrine call that which they believe (or don’t believe as the case may be) a religion? Because most of them are rebelling against the established religions of the world and using the principle set forth by the First Amendment to the Constitution of the United States of America. They don’t want to ignore the word “establishment” in that sacred document, so a new establishment of dogma and doctrine has risen to serve their needs, that being the dogma of no dogma and the doctrine of no doctrine. Resembling more the spiritual choice of the agnostic, such views are neither Wiccan nor “an establishment of religion.” If one chooses to dispute this, they may of course do so at their will. But they will look rather silly as they are disputing not me, but just about every dictionary. That religion which has neither dogma nor doctrine is not a religion.
This is not to say that someone making up his or her own religion is a bad thing. It doesn’t mean that someone without any set custom, tradition, or teaching cannot live a religious life. However, it does mean that folk who use the word Wicca to describe a Path so alien from the laws of Nature and the observations of those laws as a fertility religion are simply causing confusion. You see, the word Wicca has come to mean something, so using it to mean something totally different will just cause confusion. This is not a matter of totalitarianism; it is a matter of language. If you disagree, please try using the word anchovies to mean pepperoni and then order a pizza.
The Ethics and Dogma of Wicca
So then what are the ethics and dogma of the Wiccan religion? What can we all agree upon in our effort to establish community and tribe? Despite the fact that getting Wiccans to agree on anything is akin to herding cats, there have been some rather widely accepted attempts to create a definition. In 1974, a newly founded organization called the Council of American Witches decided to define what it means to practice modern Witchcraft. In so doing, they created the 13 Principles of Wiccan Belief and released it to the world to be freely shared.
The 13 Principles of Wiccan Belief
· 1. We practice rites to attune ourselves with the natural rhythm of life forces marked by the phases of the Moon and the seasonal quarters and cross quarters.
· 2. We recognize that our intelligence gives us a unique responsibility toward our environment. We seek to live in harmony with Nature, in ecological balance, offering fulfillment to life and consciousness within an evolutionary concept.
· 3. We acknowledge a depth of power far greater than is apparent to the average person. Because it is far greater than ordinary, it is sometimes called “supernatural,” but we see it as lying within that which is naturally potential to all.
· 4. We conceive of the Creative Power in the Universe as manifesting through polarity— as masculine and feminine—and that this same creative Power lives in all people, and functions through the interaction of the masculine and feminine. We value neither above the other knowing each to be supportive of the other. We value sexuality as pleasure, as the symbol and embodiment of Life and as one of the sources of energies used in magickal practice and religious worship.
· 5. We recognize both outer worlds and inner, or psychological worlds—sometimes known as the Spiritual World, the Collective Unconscious, the Inner Planes, etc.— and we see in the interaction of these two dimensions the basis for paranormal phenomena and magickal exercises. We neglect neither dimension for the other, seeing both as necessary for our fulfillment.
· 6. We do not recognize any authoritarian hierarchy, but do honor those who teach, respect those who share their greater knowledge and wisdom, and acknowledge those who have courageously given to themselves in leadership.
· 7. We see religion, magick, and wisdom-in-living as being united in the way one views the world and lives within it—a world view and philosophy of life, which we identify as Witchcraft or the Wiccan Way.
· 8. Calling oneself Witch does not make a Witch—but neither does heredity itself, or the collecting of titles, degrees and initiations. A Witch seeks to control the forces within him/herself that make life possible in order to live wisely and well, without harm to others, and in harmony with Nature.
· 9. We acknowledge that it is the affirmation and fulfillment of life, in a continuation of evolution and development of consciousness, that gives meaning to the Universe we know and to our personal role within it.
· 10. Our only animosity toward Christianity, or toward any other religion or philoso-phy-of-life, is to the extent that its institutions have claimed to be “the one true right and only way” and have sought to deny freedom to others and to suppress other ways of religious practices and belief.
· 11. As American Witches, we are not threatened by debates on the history of the Craft, the origins of various terms, the legitimacy of various aspects of different traditions. We are concerned with our present and our future.
· 12. We do not accept the concept of “absolute evil,” nor do we worship any entity known as “Satan” or “the Devil” as defined by Christian Tradition. We do not seek power through the suffering of others, nor do we accept the concept that personal benefits can only be derived by denial to another.
· 13. We work within Nature for that which is contributory to our health and well-being.
Unfortunately, shortly after creating the above document, the organization became defunct. Similar ethics can be found in the 13 Goals of a Witch. However, the exact wording in the 13 goals of a Witch is similar to the exact wording of The Charge of the Goddess that is often reported to belong to Doreen Valiente. The words change from reference to reference. The many incarnations of the 13 goals have been just as varied in their wording even though their likely origin was Scott Cunningham’s book Wicca: A Guide for the Solitary Practitioner, from where I now quote:
The 13 Goals of the Witch
· 1 Know yourself
· 2 Know your Craft (Wicca)
· 3 Learn
· 4 Apply knowledge with wisdom
· 5 Achieve balance
· 6 Keep your words in good order
· 7 Keep your thoughts in good order
· 8 Celebrate life
· 9 Attune with the cycles of the Earth
· 10 Breathe and eat correctly
· 11 Exercise the body
· 12 Meditate
· 13 Honor the Goddess and God
—From Wicca: A Guide for the Solitary Practitioner
By Scott Cunningham
Did Scott Cunningham write this? Maybe and maybe not. Although it is often cited to Scott Cunningham, he presented it as if it were part of the Wiccan religion as already established. Now I do think Scott created The 13 Goals of the Witch, but I do not think that in so doing his writing becomes a sacred Wiccan text any more than the 13 Principles of Wiccan Belief, or the Charge of the Goddess or any other text unless it comes from one’s own heart. In fact, I may only include it here because it is less than 250 words in length and used for academic purposes and to present critical commentary (exceptions to copyright law).
So then, like a Charge of our Mother or Father, the 13 (or whatever number) Goals of the Wiccan should come from the Wiccan heart, not a Wiccan book. This is not for legal concerns but because there is absolutely no point in creating a set of ethics or goals if you are not going to follow them and because you are not going to follow them unless they came from your heart rather than a book. In that matter, I feel the one primary Wiccan goal is the first of the 13 listed in Scott Cunningham’s book: “Know yourself.” No, those two words are not the sum total of Wiccan belief, but only with those two words can one listen to established Wiccan dogma and doctrine and determine if it sings to the soul or if maybe there is a better religious choice for you. You see, the rituals and teachings of Wicca are not the religion. Instead, your perception of those rituals and teachings are.
What Is Wiccan Community?
I called this chapter ’Liber ab Gens’ because the Latin word gens translates well as both ’tribe’ and as ’nation.’ Here, hidden in the very nature of an ancient Pagan language we find the wisdom of that which is Wiccan community. We are not a group of folk who all think identically about any one subject because the very nature of our religion forces one to decide for oneself. Contained here in this book is my personal dogma and doctrine. You do not have to agree to be Wiccan.
For this reason, using the term Wiccan community does not accurately reflect the nature of our religion. Wicca is based on knowing oneself rather than knowing the words in a book. As a result, it is a very personal religion, and while any one Wiccan is likely to share many things in common with the next, our religion is based far too greatly on the individual to envision a large community without tremendous amounts of infighting on the subject of just what Wicca is. For that reason, here I use the term Pagan community rather than Wiccan community to discuss relations larger than those of kith and kin. While not every Pagan is Wiccan, in general terms there is no greater distance between the beliefs of any one Pagan and the other than between any one Wiccan and another.
Finding Pagan Community
Currently, the main problem with finding Pagan community is found in the same reason I choose to use the term Pagan community rather than Wiccan community. For the most part, each effort to establish Pagan community has found it necessary to become a tradition or denomination unto itself. Now this in and of itself is not a bad thing, so when I discuss the following Pagan organizations, please do not think I am attacking them in anyway. But the current structure does create an obvious problem: How does one find out what traditions or groups are available to the seeker? Not a reference or a listing, but how does someone meet folk from the many different groups and traditions? How does one find the community options?
Listed here are what I have found to be top of the list of Pagan organizations, these are the finest of the finest. However, only one of the three listed has not become a tradition unto itself.
A Druid Fellowship
In my opinion, this is one of three of the finest Pagan organizations available to the seeker. Founded by Isaac Bonewits, one of the better-educated authors in the Pagan community, the central idea behind its liturgy is that although local chapters (called groves) may change the pantheons used in ritual, the basic ritual construct are the same from group to group. This way, a member familiar with ritual structure in one grove can travel the world and still attend public religious services the same way members of most mainstream religions can.
Church of All Worlds
In my opinion, this is another of the three finest Pagan organizations available to the seeker. Founded by Oberon Zell-Ravenheart, incorporated 1968 and legally recognized as a church by the IRS 1970, this is the oldest Neo-Pagan Church in the United States. The Church of All World’s local organizations are called nests and branches. A nest is usually a private organization similar to what I call a household in Wicca; others might call it a coven. Sometimes nests are public, but that is left entirely up to the discretion of the nest and not dictated by CAW. A regional collection of these nests as well as members unaffiliated with these nests is called a branch.
Comparing and Contrasting ADF and CAW
The structure of Church of All Worlds differs greatly from the ADF in that the ADF addresses its structure from the top down while CAW does just the opposite. The principle behind the structure of ADF is that if general community is made available by their local Groves, then deep personal friendships and loving relationships will form between members. Additionally, groups within each grove will mix with members of other groves in what is termed special interest groups or SIGs. Thus each Grove exists as a whole, but contains interpersonal relationships that develop naturally. The principle behind the structure of CAW is that if interpersonal relationships form into nests, then those nests will bundle together the way families do with neighbors and form branches (the public face of CAW). Both organizations attempt to achieve the same goal, approaching it from different direction, and both groups provide essentially the same form of community in doing so—circles within circles.
Spiral Scouts
This is the exception to the observation that Pagan organizations are traditions unto themselves. I would not normally list an organization that is only a few years old as one of the three finest; however, in the few years that Spiral Scouts has existed, it has far surpassed any other Pagan organization that I am aware of in approximating my view of the way the ancient Pagans must have formed community. And yet—surprise, surprise—they are of no specific religious affiliation whatsoever. Instead, they leave specific religious affiliations up to the individuals and families that unite with them. The only drawback is that Spiral Scouts was created in service to Earth-based families with children. While this is very much needed, it leaves those of us who do not have children feeling a bit left out, but we address that in just a moment.
The organizational structure of Spiral Scouts is exactly the way I envision the preChristian fertility religions must have been. While I detailed the structure of how I believe those communities must have been in my book Wicca for Couples, I did not have knowledge of the organizational structure of Spiral Scouts at the time. Their organization is the absolute best approximation of how ancient Pagan communities must have formed. Their organizational structure begins with the hearth (what I call a household). This structure is led by one or two parents (what I call the host and hostess). Should a Hearth grow to include three unrelated children, it becomes a Circle.
A circle is led by two people called ’circle leaders’; again, these are what I have called here a host and hostess. This is the core or basic Spiral Scout group. For practical reasons, these two must be members of the opposite sex, the reason being that there are matters a girl member would be best to turn to a female adult that is a woman and a boy member would be best to turn to a leader that is a man. However, these ’circle leaders’ do not rule the circle, they simply provide structure and hospitality. All parents are not only welcome to participate, they are strongly encouraged. A clan is the next largest organizational structure. Generally speaking, a clan is made up of circles that are united by a geographical area such as a city. Those clans form the next largest organizational structure, a tribe. The tribe is made up of individual clans who are united by a geographical area, such as a county.
Spiral Scouts officially started in 1999. Although my book Wicca for Couples had absolutely nothing to do with the founding of Spiral Scouts formation, after reading their literature and meeting many of its members, both adult and child, I take immense gratitude in knowing that the concepts presented in that book are shared in part by an organization as fine as this, especially that a couple is the core of community, be that community Wiccan or other. Bless you Spiral Scouts! You are the salvation of the Tempest Smiths of this world!
In the glory of our Lord and Lady, so mote it be!
Circle Guide to Pagan Groups
The problem still remains: How does one find Pagan community? You see, each of these groups is part of the Pagan Community, but with the exception of Spiral Scouts (which is child-oriented) each is also an individual tradition or denomination unto itself. Despite my tremendous favor of the above listed organizations, they might not be the one you want to join. Where then does one turn?
Some folk might tell you that Web indexes are a good option. I think they are the worst way to find like-minded folk for two reasons. Web indexes are inevitably inaccurate because they are too easy to join. Click here, fill in this form there, and presto: You are now the head of an international Pagan organization. Most important, web indexes tend to be all-inclusive without respect to the organization’s qualifications or if that organization is of good report. So what is a person to do?
Fortunately, there is a partial solution that has helped thousands of folk. That solution is Circle Guide to Pagan Groups, available from Circle Sanctuary. Circle Sanctuary is in and of itself a Pagan organization, but I have little experience with them other than to know that they are of good report. Their annual publication of which I speak is a collection of public Pagan groups and resources across the world. While Circle does not make an attempt to determine who is of good report and who is not, they do keep their list current, list national affiliations, and check their references annually by more than simply sending an email out and seeing if it bounces back. Yes, all this takes a bit of money, so there is a cost involved in acquiring their publication; that cost is well worth it. If you can not find it at your local Pagan shop, please write to the address given for Circle Sanctuary.
Organizations of Good Report Quick Reference
What follows is a list of public organizations I have found to be of good report. I neither belong to nor promote one over the other. I have mentioned having tremendously good experiences with two of these groups, ADF and CAW. However, this is not to say that these two organizations are any better than any others on this list. I have had close involvement with those two organizations, their members, and/or leadership, so I can form personal opinions on them. The other organizations on this list are those large organizations that I have been given good report of or those I have been involved with on a casual level and found of good report, but not so intimately involved that I can praise them:
A Druid Fellowship (ADF)
PO Box 17874
Tucson, AZ 85731-7874
Web address: www.adf.org
Church of All Worlds (CAW)
960 Berry Street
Toledo, OH 43605-3044
Web address: www.caw.org
Circle Sanctuary
PO Box 219
Mt. Horeb, WI 53572
Web address: www.circlesanctuary.org
Covenant of the Goddess (COG)
C/O Correspondence Officer
PO Box 1226
Berkeley, CA 19701
Web address: www.cog.org
Covenant of Unitarian Universalist Pagans (CUUPS)
PMB 335
8190 a Beechmont Avenue
Cincinnati, Ohio 45255-3154
Web address: www.cuups.org
Pagan Nation
1209 North High Street
Columbus, OH 43201
Web address: www.pagannation.com
Spiral Scouts International
48631 River Park Drive
PO Box 409
Index, WA 98256-0409
Web address: www.spiralscouts.org
Note: When contacting any of these organizations by mail, it is common courtesy to include a self addressed stamped envelope. I would also add one, two, or even three dollars and inform the organization that you have done so to defer the cost of printing literature and staffing a mailing list. Chances are these organizations either have a chapter in your area or have a program of offering support to folk who would like to form one, so if it is real life community you are looking for, please let them know when you inquire of them.
What about the Solitary Practitioner?
The question then becomes: What about solitary practitioners? This question is moot for two reasons. First, being a solitary practitioner does not mean one is an isolationist. If you are uncomfortable with group or public ritual, then do not attend group or public ritual. The only thing the phrase solitary practitioner means is that one performs ritual by oneself. It does not mean that one conducts the important part of the Wiccan religion by oneself because doing so is impossible unless you feel a religion is something that only takes place in Circle. While this might be true of other religions, the very nature of Wicca insists that it be included in our everyday life. The second, perhaps more comical of the two is that if you are a solitary practitioner but do not want community, why would you complain about the necessity to be involved in a group to find that community? Simply put, you can sit alone at home by your self night after night or you can be involved with other people (a group). You cannot do both.
Enter Pagan Nation: Stage Left
We are a Circle
Within a Circle
With no beginning
And never-ending
It is for these and like reasons that I have spent the last few years of my life creating a structure by which Pagan community can flourish, a Pagan organization that is not an organization in the traditional sense of the word. Instead of offering specific liturgy or being an organization unto itself, the organization has no rank structure, no politics, and no doctrine. Instead, the organization focuses on the idea of facilitating community simply by making it possible for folk to meet. Currently, the organization is predominantly Internet based, with an annual homecoming in Columbus, Ohio called The Real Witches Ball. We offer instant messaging and chat with a project underway to offer voice and video conferencing by the end of this year. Shortly thereafter, we will be establishing groups similar in structure to Spiral Scouts, but with the focus on providing similar contact and resources without the limitation of being focused on children or the Internet.
The idea of this organization, called Pagan Nation, is that the Pagan community is perfectly capable of establishing its own traditions and groups, but that it has fallen a bit short of providing an accessible community that is not limited by specific tradition. Our primary goal is to facilitate exchange, not dictate that exchange. As such, Pagan Nation’s first and primary goal is to establish chapters which offer the chance to meet folk socially and then let those folk decide what feels right for themselves. To that end, each chapter is charged with providing social gatherings once a month (and better it be on the same Saturday each month). It is our hope that in so doing we will promote the formation of interpersonal relationships (households) as well as membership in and the creation of local chapters of nationally and internationally recognized organizations. A friend of mine likes to compare the principle to rush day in college, but I shy away from comparing Pagan Organizations to fraternities and sororities. Although facilitating social exchange between its members is the ultimate purpose of those monthly get-togethers, just putting people in a room and telling them to interact would be a bit silly. So we incorporate a three-fold path in providing those social gatherings.
Need—The First Path
Need is the first of the three-fold path of Pagan Nation. It can be equated to the first order of life, plants, and the first degree in the Wiccan religion. In addressing this path, chapters in Pagan Nation are charged with hosting a monthly potluck dinner. To that dinner, prosperous members are encouraged not only to bring a covered dish, but whatever non-perishable food they can offer in sacrifice to the community. This is conducted in accordance with the Wiccan Rede where we are instructed to ’fairly take and fairly give.’ Although found in the Wiccan Rede, this principle is not unique to Wicca, thus I do not feel it is overly dictator like of me to say it should be included in Pagan Nation or any other such organization. The sacrifices are blessed in whatever way folk feel is appropriate and added to a pantry reserved first for the chapter. However, if that need is met, it should be shared with other food pantries without regard to their religious affiliations. Need is need, no matter what religion a person belongs to.
Service—The Second Path
Service is the second of the three-fold path of Pagan Nation. It can be equated to the second order of life, animals, and the second degree in the Wiccan religion. In addressing this Path, chapters in Pagan Nation are not only charged with the sacrifice discussed in the first Path, but in recognizing the duty that we as human beings are uniquely qualified to perform. Although this principle is presented here in the Book of Genesis as our duty to protect, tend, and serve our world, it is not a uniquely Wiccan idea. For this reason, every local chapter is charged with organizing the sacrifice of time and labor in service to our world. This can be in the order of adopting a waterway, park, or even a stretch of highway. It can be in serving meals to the elderly, reading to children in a hospital, or any other activity where one’s time is spent each month for the betterment of our world.
Now, one might feel donating cash or gifts to a community service organization fulfills this obligation. While they are certainly encouraged, they are no substitute. Remember that the primary purpose to this organization is facilitating social exchange between its members. Sending a check to your favorite charity is encouraged, but it does not facilitate that social exchange.
Celebration—The Third Path
Celebration is the third of the three-fold Path of Pagan Nation. It can be equated to the third order of life, humanity, and the third degree in the Wiccan religion. In addressing this Path, chapters of Pagan Nation are not only charged with enabling celebrations. In this matter, chapters make available places for celebrations as well as instruct in general methods of Pagan celebration; the teaching of chants, drumming, dance, and other activities come to mind.
Need, Service, and Celebration
Now, I have spoken greatly about my aspirations for Pagan Nation the way a proud father might speak highly of his newborn child. However, the principles that I have discussed for Pagan Nation are not unique to my vision of a single organization. Instead they are found in virtually every Pagan culture one can document. Why? Because they are necessary to promote community, and community is necessary for the survival of the human race.
In short, if these three Paths were not addressed, then humanity would not have made it as far as it has. If these three Paths are not addressed by humanity, we will shortly fade from existence. You see, although I speak rather concernedly about the current state of our world, comparing the current extinction rate to that of the dinosaur’s exodus from our world, the fact is it will be a great time until our sun supernovas and until then, the Earth simply will not die. Life will always find a way, even if we fail to insure it. However, if we fail to continue then we fail in our duty to our Lord and Lady. So to the survival of humanity Wiccans are also committed, and for that survival our needs must be met by the service to and from our community such that we can rejoice and celebrate. Remove any one of these three vital Paths and we crumble. This observance on a large scale, I call the Pagan community. This observance on a small (family and friends) scale, I call a Wiccan community. Within each of those communities we find both support and obligation.

Liber ab Arma
(Book of Arms)
Making a Difference in Your Community
e live in very scary times. As I send this manuscript to my publisher, there is a war unfolding in Iraq that may affect the stability of the Middle East or even the world. What follows should not be taken as commentary on that war or any specific war. I do have opinions on that war, and those opinions are easy to find at PaganNation.com. I do not try to conceal my convictions one bit. In fact, I seem to be at odds with the great
majority of Pagan authors in respect to that war.
But this chapter is not about any one conflict. It is about at the nature of conflict and how that nature determines that which is Wicca. So in this chapter, please do not read that I either support or do not support any one war. Instead, read into this chapter only what is there. See only what I have said for what it is, and do not impose upon it any prejudices based on one conflict. The ancient Pagans did experience conflict, they did make war, and they did take a firm stand on matters of right and wrong. If Wiccans do not recognize that there is a time and a place for standing on conviction, then they have very little right to call themselves Pagan as Pagan lore is absolutely filled with just that.
Consider this: You have probably heard that Wicca is a Celtic religion, which insists that conflict never solves anything. Why then did the British Celtic folk hero Cartimandua lead the descendants of the goddess Brigantia against the Roman Empire? If you
СЛОі answer is that Wicca is more Goddess focussed than the ancient Pagan religions, I won’t even argue that Wicca is a balance between the feminine and masculine, I will just point out that Cartimandua was female.
Taking up arms is the third rite of passage of Llew Llaw Gyffes, who was initially forbidden the rite by his mother who demanded that he not be allowed to take up arms until she armed him. Arming him later became exactly what she did when she was in fear for the safety of her community, and that is exactly what we do when we take up arms. We defend our community.
Now this does not mean that Wiccans have an initiation rite where guns and ammunition are distributed. Instead, it is the point on the path of Wicca when one realizes that no matter how much one detests conflict, it is sometimes not only the best choice, but also the only choice. If we learn anything from the burning times, it is what happens when one does not stand against oppression. If we learn anything from the persecution of the Jews at the hands of Nazi Germany, it is what happens when one does not stand against oppression. Have we learned anything?
The mystery of how Wicca can be a religion and yet mandate absolutely no specific morality or ethics is conflict. This is the natural order of our world, survival of the fittest. At its core, it is the science of Darwin. This is not to say that the Wiccan religion promotes war or bloodshed, but it does promote conflict in encouraging individual thought and the expression of that thought. Someone says Wiccan rites should include child molestation, I say child molestation is an abomination to a fertility religion, and you decide who is right and who is wrong. This is the taking up of arms. So interwoven is this to Wicca that, long before we became an industry standard religion given into the mass media’s desire to market books, we did not use the word tools to denote the props of our sacred theater (ritual). Instead, the athame, chalice, censor, pentacle, and other props in sacred theater were called weapons. That term fell out of favor because it was feared someone might misunderstand the word and think our religion presented a danger to the larger community—and that fluff bunny stuff seems to sell a great deal more books (read that it makes more money for Wicca’s ’secret chiefs’). But it is in not recognizing those props as weapons that there is a danger, for it is in doing nothing, allowing the world to slip into disaster that we are all in danger.
Should we do nothing as the rate of extinction exceeds that of the dinosaur? Should we do nothing as entire lines of plants are destroyed? Should we do nothing as animals are needlessly made to suffer? Do we actually have a choice? We do. Having a Wiccan soul, we do not have a choice but to feel the pain of these things, but we have a choice in what we do about it. We could recognize these things and allow them to cause us to sit and cry, or we can turn that pain into rage and bring about the manifestation of a just world by taking up arms by the expression of thought, putting that rage forth into the world, thus seeking conflict with the forces that oppose such expression, and praying that our convictions prevail.
Yes, it is tempting to scream ’Make love not war.’ But in that scream, still there is conflict, or there would be no reason to scream it. In that scream there is war, there is the demand that ones perception of that which is right be put forth to challenge that
which is wrong. This is why Pagan lore is filled with gods of war—not because Pagans are desirous of war, but because they recognize that conflict is the nature of things, and because we need someone to receive the prayers that our convictions meet with victory.

Gods and Goddesses of War Faces of our Lord and Lady
It is important to mention that these gods and goddesses have many other attributes, some of which are presented in the final chapter of this book. They are presented here in their attribute as warriors and gods of war to illustrate how important such attributes were to the ancient Pagans. Just like today’s soldiers, the willingness to make war, to take a stand on conviction, is not the whole of the being.
Agasaya—Female—Middle East
Early Semitic goddess of war.
Ah Cun Can—Male—Central America
Mayan god of war.
Ah Chuy Kak—Male—Central America
Mayan fire god and god of war.
Ahulane—Male—Central America
Mayan god of war who is called the Great Archer.
Anath—Female—Middle East
Semitic goddess of not only war, but of motherhood. Perhaps a comment on the maternal instinct to protect one’s children.
Andraste (Also known as Adraste, Andrasta) —Female—Central Europe British Celtic goddess of war. She was prayed and made sacrifice to by Queen Boudicca in the Queen’s charge against the Roman Empire.
Ankt—Female—Africa
Egyptian goddess of war.
Ara (Also known as Aray) —Male—Central Europe/Northern Europe Armenian god of war whose name means ’the beautiful.’ He can probably be linked to the Greek Ares.
Ares—Male—Mediterranean
Greek god of war whose constant companion is his sister Eris, the goddess of strife equated with the Roman Discordia.
Badb—Female—Central Europe
Irish Celtic goddess of war. She not only participates in wars, but also uses magick against the enemy to cause confusion and defeat. Interestingly enough, her lore is probably responsible for the term ’Bad Lands’ as the traditional name her followers gave to the battle field is ’Land of Badb.’
Beg-tse—Male—Central Asia
Tibetan god of war who is often depicted with a sword by his side and wearing a full suit of armor. In some traditions, he is the keeper of the divine teachings of the Buddha.
Belatucadros (Also known as Belatu Cadros)—Male—Central Europe Welsh Celtic god of war whose name means ’Fair Shinning One.’ Obviously not a reference to war being viewed as a negative, even when it is required.
Bellona—Female—Mediterranean
Roman goddess of war. She accompanied Mars and has been cited variously as his sister, daughter, or wife.
Burijas (Also known as Burigas)—Male—Middle East
Early Iranian god of war.
Bugid Y Aiba—Male—Caribbean
Haitian god of war.
Buluc Chabtan—Male—Central America
Mayan god of war.
Camulus (Also known as Camulos)—Male—Central Europe/Mediterranean Celtic god of war, particularly among the Gauls. He was identified with Mars by the Romans.
Cariocienus—Male—Central Europe
Spanish god of war. The Romans linked him to Mars.
Cartimandua—Female—Central Europe
British Celtic folk hero and queen who may be historic figure. Per lore, she led the descendants of the goddess Brigantia against the Roman Empire.
Caswallawn—Male—Central Europe
Celtic god of war, particularly on the British Isles.
Chemosh—Male—Middle East
Moabian god of war and the chief god of their pantheon. He is the giver of laws and the event that takes place when those laws are broken. He is equated to the Babylonian Shamash.
Ek Chuah (Also known as Ekchuah)—Male—Central America
Mayan god of war and patron of the merchant.
Enyo—Female—Mediterranean
Greek goddess of war. She is variously cited as mother, daughter, and sister of Ares. She is one of the Graiae, whose very name means ’horror.’ As such, she is often depicted covered in blood.
Eshara—Female—Middle East
Chaldean goddess of war.
Futsu-Nushi-no-Kami—Male—Far East
Japanese god of war, as well as lightning and fire.
Guan-di (Also known as Emperor Guan, Kuan-ti, Kuan Yu)—Male—Cen-tral Asia
Taoist god of war in opposition to the disruption of peace. (Yes, I did say Taoist. Contrary to popular modern belief, most cultures, religions, and philosophies have recognized the need for war. Perhaps I should say most surviving cultures, religions, and philosophies.)
Gun—Male—Africa
African god of iron and war. His name and the attribute of iron affords some very interesting speculation.
Huitzilopochtli (Also known as Uitzilopochtli)—Male—North America Aztec sun god and god of war. Interestingly enough, he is associated with the hummingbird. This could be a comment on the swiftness of war.
Ictinike—Male—North America
Sioux god of war, as well as the teacher of the Sioux tribes in the art of war.
Indra—Male—Near East
Hindu god of war from the time of the Vedics.
Inanna—Female—Mediterranean
Sumerian goddess of war.
Kartikeya (Also known as Karttikeya, Muruhan, Skanda, and Subramana)— Male—Near East
Hindu god of war and leader of the divine armies of heaven.
Korrawi (Also known as Katukilal)—Female—Near East
Dravidian goddess of war and victory.
Ku—Male—Polynesian Islands
Hawaiian creator and god of war.
Laran—Male—Mediterranean/Central Europe
Etruscan god of war who is depicted as a boy who is sky clad except for a helm and carrying only a spear.
Mars—Male—Mediterranean
Generally referenced as the Roman god of war; however, there is a great deal more to his story. He was first seen as a god of nature, fertility, and of the Earth. Gradually he changed into a god of war, as war became necessary for the survival of his people.
Maru—Male—Polynesian Islands
Maori god of war who instigates conflict for the purpose of being witness to the result of that conflict. He taught the use of weapons and the use of magick against the enemy.
Mentu (Also known as Menthu, Mont, Month, Monto)—Male—Africa Egyptian god of war and patron of warriors.
Mexitl—Male—North America
The god of war from whose name the nation of Mexico comes.
Neith—Female—Africa
An Egyptian goddess of war. She is depicted with bow, shield, and quill. Although she is sometimes cited as a huntress, the shield indicates that she had other attributes as well.
Oro—Male—Polynesian Islands
Tahitian god of both war and peace. Another example of the need of one to enjoy the other.
Reshep—Male—Middle East
Syrian god of war, disease, and the Underworld.
Rugiviet—Male—Central Europe/Northern Europe
Slavic god of war.
Sakhmet—Female—Africa
Egyptian goddess associated not only with war, but also with revenge.
Samulayo—Male—Polynesian Islands
Fijian god of war who welcomes the slain in battle.
Segomo—Male—Central Europe
Celtic god of war and victory in all matters of conflict, particularly among the Gauls.
Septu (Also known as Sopd, Sopdu)—Male—Africa
Egyptian god of war and victory.
Set (Also known as Setekh, Setesh, Seth, Seti)—Male—Egyptian
Egyptian god of chaos, disorder, and the wars that bring those things.
Shamash—Male—Middle East
Babylonian god and giver of law. He becomes god of war when those laws are broken.
Si—Male—South America
The Mochica (pre-Inca) personification and god of the Moon. He is also a god of war depicted in full armor.
Svantetit (Also called Svetovit)—Male—Central Europe/North Europe Slavic god of both field and war, that relationship being in the capacity of protector of the fields.
Triglawus (Also known as Trigelavus, Triglav)—Male—Central Europe/ Northern Europe
Slavic god of war with three heads representing heaven, earth, and the underworld. This is likely commentary on the fate of warriors. They might survive the battle (Earth), they might fall in a just cause (Heaven), or they might fall in a cause that is not just (Underworld).
Tu Matauenga (Also known as Tu)—Male—Polynesian Islands
Polynesian god of war. He is equated to Maru (Maori) and Ku (Hawaii)
Tyr—Male—Central Europe
German god of war and justice, which seems to predate the lore of Odin. There is some evidence that suggests Tyr was the predecessor to Odin, but that by the time of the Vikings, lore had grown in such a way as to record him as Odin’s son.
Wepwawet (Also known as Ophois, Upuaut, Wep-wawet)—Male—Africa Early Egyptian God of war who is depicted with a jackal head.
Wurukatte—Male—Middle East
Early Hattic god of war.
Zababa—Male—Middle East
Akkadian god of war.
Zi-yu—Male—Central Asia
Chinese god who invented both war and the weapons with which wars are fought.
The Need for Victory
Indeed, the ancients recognized the need for victory. They knew that without the sense of challenge and conquest, humanity becomes complacent. Realizing the great harm that war brings, they devised methods by which such challenges and conquests could be accomplished without the act of war. Not all of their ideas were the most humane. In fact, some were degenerative forms of entertainment in which men were pitted against each other not for their longing of victory, but because spectators wanted to feel what it was like to be pitted in life versus death combat while remaining in the relative safety of their Colosseum seats. The ancients were not perfect. But they did try. In fact, our modern Olympic games testify to the fact that the ancient Pagan Greeks sought appeasement to this lust for victory in the creation of great sport. Elsewhere we see limitations placed on war, such that single combatants meet on the field rather than entire armies.
Anguish, a king of Ireland, sent his brother-in-law Morholt to face single combat with the Cornish Tristan. In that combat, Tristan fell Morholt so it was not a deathless battle, but it was a battle that involved only one death. As such competition can be found in a great deal of Celtic lore, we can safely say that the Celts may have been dedicated to war when war was necessary, but when it was not they reframe from combat, and when combat was inevitable they did what they could to limit the loss of life.
Additional indications as to how the ancient Pagans felt about war can be found in the many connections between war and crop fertility, the central message being that should a nation be prosperous, war is not likely. Should a nation starve, war was inevitable. You might recall I mentioned the barbarism of one of Rome’s most notorious forms of entertainment. History has shown that the Roman people should not be judged by one event alone and neither should their attitude towards war. Why? Well, there is very clear evidence that they were not the bloodthirsty monsters that the coliseum battles between Gladiators portrays. Indeed, one of their holidays even involves praying that the weapons of war rust. While that principle is represented widely in lore, it is found no more clearly than in the Robigalia celebrated on Aprilis 25. The Robigalia honors Robigus and Robigo, god and goddess of rust in one form or another. At their festival, prayers were conducted asking them to rust the weapons and tools of war rather than to rust (blight) their crops. Please let our crops do well, so our armies will not have to make war to feed us.
When to Fight
How do we decide what we should and should not take up arms against? Where is this great book of wisdom that tells us right from wrong? If it is so clear that the ancient Pagans were willing to stand against what they saw as wrong, why can we not just have a book to tell us what those wrong things are? The reason Wicca does not have a list of things one should or should not do is the creation of such a list would destroy the very nature of our religion. Doing so is why we see those most annoying sidewalk preachers who can tell right from wrong simply by reading the pages where those rights and wrongs were written.
At a march conducted in Columbus, Ohio for the National Organization for Women, there was one such preacher whose wife had a sign that read “Feminism is Satanism.” She looked none too thrilled to be standing there with that sign. Normally, I tend to taunt such protesters, but I couldn’t. The punishment for her ignorance was already standing right beside her, her husband. Now maybe, just maybe, there was a time in which men needed to be in charge. I have noted that patriarchal communities tend to develop where life is hard. Maybe, just maybe, the time in which that book of theirs was written when such matters were life preserving. Even so, that time is not now. Yet, there it is in that book of theirs, that god is the head of every man and that man is the head of every woman.
I saw that same preacher protesting with a gas mask on the sidelines of the gay pride parade. His sign read “Homosexuality is Satanism.” Again, I thought about taunting him, but I couldn’t. It was about a hundred degrees and he was wearing a rubber suit and gas mask so he wouldn’t contract AIDS from the gay and lesbian folk in the parade. To be perfectly honest, I can’t say for sure that it was the same person. But I have seen that same person with a similar sign so often that I have come to expect to see him at Red Lobster with a sign that reads “Seafood is Satanism.” You see, that book of his forbids that as well.
That is why we do not write down a set of 10 (or any other number) of commandments. Although Wicca is modeled on some truly ancient religions, we have the benefit of observing how other religions have failed. Should we write these things down, we become just like those failed religions that now threaten global peace.
On Crone and Sage
You will note that I equate the taking up of arms to the Crone and Sage state of our Lady and Lord. As such, I believe this to be the core knowledge of the third degree of Wicca: Now that you have knowledge of the first and second degree, it is time you do something with it. In the degree system more akin to Gardner’s system, the third degree is the point where one can hive off of his or her original coven and form one’s own. Remove that artificial coven system from the equation and we realize the third degree is the point where Wiccans are able to make their own stand (hive off). It is the point where they have received the secrets, explored the mysteries, and have awakened that Wiccan soul that I have spoke about so much thus far. It is the point when we welcome others whose hearts have awoken, but we no longer depend on their example. It is the point when we no longer mix our potions and play with our familiars because it is the Wiccan thing to do, but when we realize that although those practices are valuable in and of themselves, their main purpose was as a stepping stone from which to launch our understanding of our relationship to the world we live in. We have been there, done that, and are now moving out into the world to provide the same service to others who would listen.
In this, we see that the role of taking up arms is not only the act of speaking out and attempting to manifest our world for the better, but it is also the act of handing down our traditions to the folk who follow—not by writing books, forming covens, or any of the ways one might think, but in leading by example. Thus, the very act of assuming a posture in which one makes their feelings known is the act of handing down traditions and guiding our younger folk into the mysteries of our religion. Sure, there will be opposition to those opinions, but that is what the law of Nature is all about.

Liber ab Mentis
(The Book of Mind)
he reason I placed the Book of Familiars in between the Book of Soul and the Book of Mind is because that is exactly where we see them, somewhere between the soul that they possess and the mind that we use to understand that soul. That is how we decide the difference between right and wrong, somewhere between what our soul and mind tells us. That is where we find truth—right where truth is so often found, right smack in the middle.
This is also the conflict that I spoke of in the last chapter. It is the adversarial system by which we judge our own actions and inaction. It is similar in concept to the taking up of arms, but in the conflict between our nature (soul) and our nurture (mind), the assumption that emerges from this conflict is truth. Our soul (subconscious/ego) throws out a primal emotion and our mind (conscious/super ego) either puts it down or brings it into manifestation. In a court of law, this is the difference between premeditation and a crime of passion. This is a very important part of that which I term Spirit because without that mind causing intentional manifestation, the soul unchecked will produce unintentional manifestations.
In a previous book, Wicca for Men, I put forth the idea that there is a clear difference between animals and humanity. This is why I prefer the athame to the wand for
ІСАО ІС4О
use in ritual. You see, although animals have been proven to do just about all of the things we used to claim made them different, they have not as of yet developed the ability to work metal. Some animals do indeed build homes, have language, teach language to others, make love facing each other, practice monogamy, live in extended communities, and so on. Practically every thing we have used to separate humanity from animals has been disproved, except one. In reflecting on the Elements, other religions claim the one Element that animals do not demonstrate is Spirit.
It might surprise you to know that I agree, but only in the semantics of how I use the term. I do very much believe animals have soul, but when I use the term Spirit I mean much more than soul. I mean soul tempered with mind. Because that tempering process can be equated to Fire, I note Fire as the one Element of the four that animals do not possess a mastery of. I do not believe humanity has mastered Fire. But we are the only critter that has made an attempt thus far.
While presenting this concept in workshop forum, one person in attendance insisted that by acknowledging the difference between humanity and animals that I was claiming humanity is better than animals. I explained that I believe all Life is sacred, but could not resist the opportunity to do just a little bit of vegetarian proselytizing. “Do you eat meat?” I asked. The truth of the matter is that I have chosen to be a vegetarian, but do not generally think that eating meat is wrong. I think it is wrong for me but do not condemn others for doing exactly what I have done, which is to make an educated personal choice. The thing is, the person in that workshop had clearly not made an educated personal choice. He was telling me it is wrong to consider animals different than human beings, yet he doesn’t eat human beings.
There is a clear difference between animals and humanity. That difference is represented in our lore, in our language, and in the way we conduct ourselves every day. I have shown that the ancients were rather clear in their belief that animals have soul. I have shown that so strong was their belief that it is built into our modern language. Now let’s look at what animals and humanity do not share: mind. Again I turn to my dictionary where I find the very first definition for mind is:
“The human consciousness that originates in the brain and is manifested
especially in thought, perception, emotion, will, memory, and imagination”1
Human consciousness is the tempering fire that I speak of. Those same folk who argue that I should not point out the difference between humanity and animals are usually the first to point out that only humans have developed the nuclear bomb (fire). Of course I agree, yet even though they argue my very point, they still will not concede that there is a difference between humanity and animals. If there is no difference, then does it not stand to reason that humanity is just as responsible for this Earth as is my cat? Therefore, does it not stand to reason that we should do just as much to save the Earth as my cat, that being nothing at all?
The ancient Pagans saw the clear division between animals and humanity by the attribute of mind being given to only humanity, and they demonstrated that belief in their lore.
Alaghom Naom—Female—Central America
Mayan goddess whose name means ’mother of mind.’ In the Mayan, pantheon she is chiefly responsible for the creation of human consciousness.
Mens—Female—Mediterranean
Roman goddess of human consciousness.
Naum—Male—Central America
Mayan god who is attributed as the father of mind. In the Mayan pantheon, he is chiefly responsible for the creation of human consciousness. He is either husband to or a male version of Alaghom Naom.
Sia—Female—Africa
Egyptian personification and goddess of human consciousness.
It is by recognizing that humanity has this unique attribute that we understand our unique responsibility. Can an animal be blamed for over-populating and causing environmental disaster as the foliage, their food, recedes, allowing the topsoil to be eroded and the land to become barren? When those animals do this, should they be blamed for their own starvation and the suffering of other animals in their area? If one does not acknowledge that animals are incapable of being mindful, then one must blame them for following their soul to the point of extinction.
If, however, we acknowledge that animals cannot make mindful decisions, then we begin to understand why the Earth is in the condition it now is. We, humanity, have not stepped up to bat in our capacity as caretakers of this planet. As a whole, we have not committed to the very duty to which we were created. As a result, we have become guilty not only of neglecting the world which our Lord and Lady have given us to shape, but we have become gluttons and allowed ourselves to harvest entirely more than we need. In that acknowledgement, we see that we have not only neglected our duty to maintain a healthy balance, but we have far tilted the scales. If something does not change, it will not be just the animals of this world that become extinct. It may well be the Earth herself.
Fire and the Mind
Fudo—Male—Far East
Japanese god of both fire and wisdom. An additional Japanese reference can be found in the trident named Kongo, which was originally owned by Koya-no-Myoin. Reportedly that trident provides men with wisdom from its flames.
Kali—Female—Near East
Hindu goddess described as the ’Black Flame’ who blesses the seekers of knowledge, wisdom, and the secrets of the gods. She is referred to as she who destroys ignorance.
Svarog—Male—Central/North Europe
Slavic fire god is responsible for formalizing marriage with mindful contracts and obligations.
Perkons—Male—Central/Northern Europe
Russian and Lithuanian fire god by whom oral contracts were thought out and sworn to mindfully.
Accepting the Fire
Ancient Pagan lore is rather clear that fire sets humanity apart from animals. Although I would like to say that mastery of fire is what sets us apart, the ancient wisdom is rather clear that there was always speculation as to whether humanity was ready for that knowledge or if that knowledge might not be so great as to cause humanity to use it for great harm.
Prometheus—Male—Mediterranean
Prometheus stole fire from Zeus. Per Greek lore, the fire of which they spoke was not only sacred, but it was in the possession of the gods alone. It seems clear the lore is not talking about the fire that comes from rubbing two sticks together.
Yehl—Male—North America
Tlingit god who stole fire and gave it to humanity. As he is also the inventor of human culture, we see again the connection to mind, culture being a product of mind.
Ilmarinen—Male—North Europe
Finnish god who gave fire to man and instructed in the mindful art of the metalsmiths.
Wekwek—Male—North America
Tuleyone falcon who stole fire and in so doing set the Earth on fire, illustrating the instant repercussion for stealing fire. With what the world is experiencing right now in the Middle East, can there be no doubt this was a warning?
Is Not Fire More Akin to the Soul?
One might argue that if we are to assign the Elements Water and Fire to that which is soul and that which is mind, that it might be better to assign Water to mind and Fire to soul. But it is the very nature of Fire to consume its fuel and burn out, as does the mind. It is the nature of Water to remain eternal, as does the soul. Can we argue that a heated argument is not found more in the mind than in the soul? If we did, how would we explain the way lovers make up? The Fire, the thought of mind, burns itself out leaving the lover’s souls like Water to mingle. If we were to take that stand that mind is best equated to Water, what would our view of humanity be? An eternal war maker?
I say nay, the soul of humanity is pure, but our thoughts sometimes muddy that purity. Our mind sometimes gets in the way. After all, Fire is the Element of war, and that Fire is exactly why Zeus and others were very guarded when it came to matters of Fire’s possession by humanity.
Consider the Haitian Voodoo Ogoun, who is god of not only Fire and war, but also of politics. If that isn’t a clear message about the nature of fire, mind, and war I do not know what is. Over and over we see the connection between fire and war: Futsu-Nushi-no-Kami (Japanese), Maru (Polynesian), Ah Chuy Kak (Mayan), Mixcoatl (Aztec), Camaxtli (Aztec), Resef (Egyptian & Phoenician), Bishamon (Japanese). These are all gods associated with both Fire and with war.
And of course let us not forget the Christian lore that actually predates Christianity. In mix of ancient Mediterranean lore on which the Christian story was based, we see that Yahweh told the other deities that he wanted to create Adam and give unto Adam the intelligence of the gods, the ability to think for himself. All of the other deities, including the Earth herself, opposed this creation because they agreed that the line of Adam would result in the fires of war.
Fire as Creative
This is not to say Fire is in and of itself a destructive force. Although it is the Element that promotes the fastest change and that fast change is sometimes described as being violent, Fire is also the tool of the craftsman. In the same Element that drives us to war, we find the soul driven to create. In this, we see that Fire by its nature might well be destructive, but when mastered it is creative. Who can argue that this is not the very nature of human intellect? That genius brings us such things as both our greatest artisans and our greatest villains.
Hephaestus—Male—Mediterranean
Greek patron of all forms of the arts, but particularly of the metalsmith.
Svarog—Male—Central/North Europe
Slavic fire god, mentioned earlier, who is also patron of the metalsmith.
Goibniu—Male—Central Europe
Irish god of the smith’s fire who is said to create swords that remain so true, they were thought to possess great magick.
Fire and Water/Soul and Mind
Separating Fire and Water to explain the two has been difficult because they are so strongly fused. Once a blade is forged, can one separate the fire and the water used to temper it? Who can say where the fountain and the fountainhead separate? Just as that which a person is after being born of a mother and father cannot be separated back into mother and father without the destruction of self, that which is the nature of a person’s being cannot be separated into masculine and feminine. Where Wiccan rituals mark life by noting the union of the feminine and the masculine, that speaks only to the union itself. The product of that union, the magickal child, is neither wholly male nor wholly female. Instead, it is a union of the masculine and feminine that can not be undone without destroying that which is created.
This is the Egyptian ’ba’ (soul) and ’ka’ (human life force). The ’ba’ is present in both humans and animals, but the ’ka’ is unique to humanity and the gods themselves. Seen in many facets of the Hindu traditions, it is the Water (soul/feminine) which is controlled by the fountainhead (mind/masculine). Neither male nor female should feel insulted by this, as we are not discussing that which is male or that which is female. Every man and every woman is a composite of that that which is soul (feminine) and that which is mind (masculine). Every man and woman is equal in that they are a composite of what the Chinese called the Yin (feminine, Earth, soul) and the Yang (masculine, sky, mind).
Culture |
Feminine |
Masculine |
Egyptian |
Ba |
Ka |
Chinese |
Yin |
Yang |
Japanese |
In |
Yo |
Hindu |
Fountain |
Fountainhead |
Wicca |
Chalice |
Athame |
The Conception of Spirit
This is one of the many reasons the Wiccan religion is applicable not only to heterosexual couples, but also to solitaries and the many gay and lesbian members of our community, as well. Some see the Great Rite as a symbolic act of heterosexual union, but it is not. Even the physical act of sex is nothing more than a symbolic Great Rite. While this is not to say that sexual unions are not sacred in and of themselves, that which is termed the Great Rite is greater than any physical act. It is the mingling not only of the soul, not only of two separate beings, but the mingling of the ba and ka within the individual. At its essence, the Great Rite is the symbolic conception of Spirit as the place in which soul and mind meet.
The symbolic Great Rite, as the athame of Fire into the chalice of Water or as penis into vagina is not only an affirmation of Life, the union of masculine and feminine. It is a promise. It is the acceptance of the responsibility given to humanity upon its first ascension. It is the affirmation that we have indeed accepted that fruit, and now we will revel in the rewards of empathy as seen in the great joys of one of the symbolic Great Rites, and we will also live up to our promise to temper that soul—joy, sex, revelry—with mind. The Great Rite is therefore the affirmation that our Spirit has been born, the sum total of soul and mind.
On Will, Dharma, Duty, and Soul
In Thelema, it is called will. In the many forms of Hinduism it is called dharma which translates loosely as duty. In Wicca, I say that it is best termed Spirit. It is what we mean when we say ’so mote it be,’ an affirmation that both mind and soul agree. You see, the will spoken of in Thelema keys on duty to oneself, and the dharma spoken of in the Hindu paths speaks more to the duty to ones line. The Wiccan concept of Spirit recognizes both of these things in the Rule of Three times three.
Will |
Father |
Duty to oneself |
Dharma |
Mother |
Duty to one’s community |
Spirit |
The Magickal Child |
Duty to oneself and one’s community |
Spirit is the sacred center, the place one cannot see by looking either outside of oneself or inside oneself, the place only seen by recognizing both. That recognition is the marriage of self with community, the knowledge that those things that benefit the self also benefit the community, and the knowledge that those things that benefit the community also benefit the self.
Wicca and Sex
Right about now a few folk are wondering why I have equated these matters to sex. My answer is rather simple: Wicca is a fertility religion. Now, this does not mean that Wiccan rituals involve sex; nor does it mean that all Wiccans must become parents. Indeed, there are many Wiccans who should not become parents just as there are members of every religion that should not become parents. Let’s face it, the world is getting pretty crowded.
Instead, Wicca is a fertility religion because Wicca explains the world in which we live very much as did the ancient Pagans on which our religion is based. But it is also a modern religion, embracing science as well as lore. This is why we term these principles masculine and feminine—not because we think one is better than the other, but because natural observation has told us that the way we create life is by male flowing into female. If you think this view is sexist, please consider: That which is light (masculine) is said to flow into that which is dark (feminine). So is it the light (masculine) acting on the dark (feminine), or the other way around? That which is hot (masculine) is said to flow into that which is cold (feminine). So is it the warmth (masculine) acting on the coldness (feminine), or the other way around?
Thus, we see Spirit as the manifestation of the magickal child that is formed when mind (masculine) flows into soul (feminine). We see the active (mind) flowing into the potential (soul) as conception. Thus, the nature of the magickal child is revealed, and the core of Wiccan ritual is known. Although the symbolism of Wiccan ritual is most certainly sexual, it is not a celebration of the conception of a child as manifested in flesh and blood, but in the conception of one’s Spirit as manifested in the people that we are and the people that we hope to become.

Liber ab Mortuus
(Book of the Dead)
here have been many cultural ’Books of the Dead,’ none of which are titled the ’Necronomicon.’ Instead, that title is what a fantasy novelist named Lovecraft invented for use in his stories of fiction. Although he reported being asked numerous times about a copy of the Necronomicon, he said over and over again that it did not exist. Then, seemingly out of the blue, a book by that title appeared on the pulp paperback market with that very title which alluded to a connection with Aleister Crowley. The book was not written by Crowley and probably not even by Lovecraft. You see, you cannot copyright a title, so it was probably written by someone hoping to capitalize on Lovecraft’s fiction. That book has probably made the author more money than the Satanic Bible made for Anton LeVey. You see, books are judged by not only their cover, but also their title. Frankly, spooky titles sell books.
I have not titled this chapter to be dark and spooky. I have titled it because it fits. Although religion is a matter of how we live, it is also a matter of how we die. The word means to re legion, to have union again. In this word, we see the nature of things. It is the path by which we find reunion, the Path we started at our birth, our separation, which leads us to our death, the reunion. But what then?
ІСАО ІС4О
While assembling a video chat server for the online community at www.Pagannation.com, a friend of mine named Duane and I were descended upon by modern day missionaries. For some reason, they seem attracted to Pagan shops such as mine. After they dispensed with the formalities of determining that we are not saved, they moved on to what they must have thought would be our breaking point:
“A.J., what happens after you die?”
I answered by simply stating that because I am not dead, I don’t know. They were happy to inform me, so I assume they were dead. After all, unless you are dead how would you know for sure? I couldn’t provide them with an answer, and I cannot provide you with an answer. I cannot tell you what Wiccans think about death because it is far too personal a matter to dare attempt to speak for Wiccans in even the most general of terms. Nor can I provide you with rituals that will ease the hearts ache at such a loss. But I can tell you that the pain of loss is normal, and I can tell you how I feel about the subject.
I do not believe ashes to ashes and dust to dust is appropriate terminology to sum up the life and accomplishments of anyone with even the tiniest life. So rather than recognizing my death when it comes, I beg of my kith and kin that they recognize my life and the lives that I have touched rather than mourn my loss.
Do with my body what you will. Bury or burn it. Set it afloat, or feed it to the fish. I do not care because whatever my fate is, that fate is no longer attached to the flesh that I once inhabited. If you think it would raise a smile, prop it up at my wake with Guinness in one hand, and don’t forget the Guinness for the folk who come to celebrate my life rather than wallow in my death.
That’s it. No funeral, ritual, or large production, just a party so I can look down (or up, as the case may be) and see that the folk that I love will continue in love after I have died. Should you want to comfort the folk who were particularly close to my heart, then tell them my tales. Instead of rambling on about what a loss my death was to the world, ramble on about how different the world would have been should I have not lived and be grateful that I did. If that is too much to ask, then don’t drink my damn beer.
You see, in all of our talk about there being no judgment day, when that thread is finally cut, I believe very much that a person’s life can be judged by the stories one can tell of his or her life. After all, what else would our earthly legacy have to know us by if not our stories?
On Facing Death
“My name is Damien Echols and I am on death row in Arkansas.”1
After receiving that letter, I spent weeks searching for help on how to reply. I have decided there is not one book on the subject of giving spiritual advice to someone on death row, much less for someone who is on death row with virtually no evidence brought against him except for his involvement in a minority religion. With the complete and total failure of Pagan books to address the issue, I turned to the more established clergy of other religions. Maybe it should not have surprised me that everyone I spoke to advised me that being right with God was in order. Maybe I should not have been surprised because I have always felt that living as a Wiccan is a harder path than that of other religions. Why would facing Death as a Wiccan be any different? “Thou are god,” thought I. What about being right with yourself? How does a Wiccan face Death?
I thought long and hard on the subject, and then I remembered the circumstances that once caused me to be in that dark place with a twelve gauge in my mouth. I was sick and had given up on life. I had come to the conclusion that there was nothing I could to do to change the eventuality of my death. But I am only able to recount this story to you now because something happened to me that would forever change the way I live, thus changing the way I hope to face Death when it finally finds me. In that moment I received a simple message. If I wanted to live, then I should not support death. Of course, with the illness that ravaged my lungs and the belief that inaction is an action unto itself, that message meant one thing: Fight!
That is how I now hope to meet my death—not in peace, but in combat. Not in a battle against Death itself—no, Death is the natural conclusion to Life—but in a battle against the same forces that I combated during my lifetime. I hope to die combating those forces that stand in opposition to what my Spirit dictates. While I have been told that when death is seemingly imminent, one should comfort folk and convince the dying to accept that eventuality, I cannot in good conscience do so because I am living proof that some times death is only seemingly imminent, and the very thing that may cause Death to turn and look the other way is how we accept Life, not how we accept Death.
So what does someone say to someone that is on death row for a crime that he says he did not commit? One says the same thing one would say to anyone that is facing Death for whatever reason: One should face Death in the way one faces Life, by recognizing that which one’s Spirit demands and fighting anything that would oppose those demands. One tells him that if Spirit demands that he scream his innocence, then he should do just that until the very last moment. For it is the very act of living at the moment one thinks he might die that may well be what is necessary to postpone that moment of death for many, many years to come. One tells him to never, ever give up or give in!
The Afterlife
Thus far, Wicca has not developed much of a detailed afterlife concept. As none of us have been there and returned to tell the tale, no one really knows. If the belief in reincarnation is a fact, then folk don’t tell that tale much because they do not remember it to tell. In truth, I do believe firmly in reincarnation. The thing is, I do not generally believe folk when they tell me their wild tales. I have lost count of the number of folk who claim to be Hitler and Napoleon reincarnated. Okay, maybe Napoleon had some good points, but Hitler? I am reminded of the song Industrial Disease by Dire Straits: “Two men say they’re Jesus. One of them must be wrong.”
Ask a hundred Wiccans about almost any other subject and you will receive almost a hundred answers. Ask a hundred Wiccans about the afterlife, and you will probably receive only two answers: Reincarnation and Summerland.
Common Wiccan Reincarnation—The common Wiccan belief in reincarnation centers around the idea of learning and life on Earth being an educational Path. We live, we learn, we die, and then we start over, with no ending in sight or much of a speculation as to why it is that we are living over and over again. It is as if we are professional students, destined never to have a job, never needing to demonstrate that acquired knowledge or put it to work.
Common Wiccan Summerland—The common Wiccan belief in Summerland is similar to the Greek Elysian Fields, only everyone gets to go there, and everyone can leave whenever they like. It is to reincarnation what spring break or summer vacation is to college or the public school system.
What strikes me as odd is that if Wicca is a Nature-based religion, these common views of the afterlife do not seem to fit. From where I sit, life involves work and while education can be incredibly valuable, without putting that education to work it becomes rather useless. Even after working hard one’s whole life, there is further work after retirement. So why then would the afterlife be any different?
Reincarnation?
Reincarnation has been a central belief in many religions, but not as the superficial thing that it often becomes in the superficial portion of the Wiccan community. In other religions, reincarnation could be used as a teaching tool, but it was also a punishment. In Hindu lore, one such punishment is to return as a Preta. This punishment was given to gluttons, folk who consumed far more than they need. The Preta are disembodied spirits sent to walk the Earth forever, always able to see those things they had been gluttonous for but never able to consume them, always thirsty but never able to quench that thirst. Additional tales of such punishment can be found in the many stories of the dead being chained just outside the reach of water for an eternity.
Generally speaking, the common Wiccan belief in reincarnation is unique to Wicca. While Pagan religions did demonstrate a belief in reincarnation, where one would reincarnate and what that person’s next life would be was in direct relation to the way one lived his or her current lifetime. In other words, graduating from one grade level might have meant moving on to the next, but failing did not necessarily mean you would repeat the class. Instead, depending on how badly you failed, you might be expelled, as the Preta, or you might have to start again at the beginning.
Summerland?
Generally speaking, like the common Wiccan version of reincarnation, the common Wiccan version of Summerland is unique to Wicca. Nowhere in all of Pagan lore can we find a system in which everyone who dies goes to a pleasant place. Nowhere in all of Pagan lore is everything forgiven. Yes, the Wiccan version of Summerland resembles the Greek Elysian fields, but not all were welcome there. In all the modern Pagan community’s declarations that they do not believe in the existence of Heaven and Hell, what they have effectively done is to rewrite Pagan lore. Yes, the ancient Pagans believed in Heaven (Summerland) but they also believed in Hell (Winterland). In fact, the very name hell comes from Pagan lore.
Traditional Pagan Winterlands
Norse Winterland
The Norse Underworld is called Helheim. It is ruled by the goddess Hell and also called by that name. The entrance to Helheim is guarded by a horrific flesh-eating hound called Garm, who stands aside to let all in but prevents anyone from leaving.
Greek Winterland
The Greek Underworld is ruled by Hades and his wife Persephone. Hades is judge and ruler of the dead. His name is also the name of the Underworld itself. The entrance to Hades is guarded by Cerberus, a monstrous three-headed dog who allows all to enter but none to leave.
Roman Winterland
The Roman Underworld is ruled by Pluto and his wife Proserpina, described as a place from where none return. Of course, there have been a few exceptions. Pluto’s wife Proserpina comes to mind. The name of the Roman Winterland is Avernus, but they also called it by the Greek name Hades after the cultures merged. Avernus is also the name of a large opening in the Earth in Campania, which was thought to be the entrance to the Underworld. The entrance to Avernus is guarded by the goddess Mania, a goddess of horrific insanity. In the Roman Underworld is found the personification of hunger as Fames, poverty as Egestes, death as Letum, and many other similarly gods and personifications, the collective of which are called the Inferi Dii
Similarities in German, Roman, and Greek Winterlands
Culture |
Name |
Guard |
Lord |
Lady |
Norse |
Hell or Helheim |
Garm |
Ganglati* |
Hel/Hell |
Roman |
Avernus |
Mania |
Pluto |
Proserpina |
Greek |
Hades |
Cerberus |
Hades |
Persephone |
* Ganglati is Hel’s servant.
Mayan Winterland
Mayan lore speaks of an Underworld with nine levels. Exactly which level a person would be sent to upon his or her death was determined by the actions of one’s life. The lowest, most horrific, level is Mitnal. It is the place from which none ever return, the Mayan Winterland.
Aztec Winterland
Like the Mayan, the Aztec Winterland is the lowest level of the Underworld. It is ruled by Lord Mictlantecuhtli. After great challenges and dangers, the souls of all who travel here find rest in oblivion.
Traditional Pagan Summerlands
The ancient Pagans also saw a Summerland, a place where life was easy. I presented some of the many Winterlands first to illustrate the point that there are indeed places that are not too pleasant. Those things should be just as part of our lore as the following eventualities.
Aztec Summerland
In Aztec lore, everyone who dies goes to Winterland unless they died bravely or in the act of giving birth. For these souls is reserved a splendor which is not possible to imagine or describe.
Celtic Summerland
Called the Mag Mell (’plain of joy’) or the Tir na n-Og (’land of youth’), this is what you have heard of the Wiccan Summerland. It is a perfect island or sometimes a realm hidden deep beneath the ocean.
Greek Summerland
This is the Elysian Fields, no doubt one of the sources for the neo-Pagan Summerland. What the neo-Pagan movement left out is that although this is a place of Nature’s splendor where Summer never sets, only those chosen by the gods are allowed to reside here. Also called Elysium and Elysion.
The Judgement of Souls
So we see a Summerland and a Winterland, a nice place and a not so nice place. How is it that souls are sent to one or the other? The answer is that although we have a knee jerk reaction to the idea of a judgement day, this principle can be found in many ancient Pagan religions. You see, it is this judgement that sets Wicca apart from most mainstream religions. But it is not in denying the principle of judgement; it is in embracing it. It is in the idea that we are responsible for the things that we do and our sin (for lack of a better word) cannot be washed away by speaking a few words, changing our religious choice, or saying a few Hail Marys. Yes, we do decide what our afterlife will be. But we make that decision in the actions of our lifetime and our lifetimes.
Egyptian Judgement
Anubis takes the deceased to the house of Osiris and into the Hall of Two Truths. There, a court is held to determine what one’s final disposition will be. Unlike the courts of men, here there are no lies because the prosecutor is Thoth, the personification and god of Truth itself. Sitting as judge is Osiris with the assistance of Isis and Nephthys who are at his sides. The soul, or sometimes the heart, is then placed on a balancing scale along with its sin, the actions of the mind. On the other side of that scale is placed a feather from the crown of Maat, goddess of truth. Should the weight of the soul with its sin be greater than the feather, it sinks and is devoured by Ammit such that there is no chance of afterlife or reincarnation. Instead, the soul becomes nothing.
Babylonian Judgement
Similar to the Islamic Katib, the Babylonian record keeper is Belit-Sheri. She records the actions and inaction of a lifetime and presents that record to the Queen of the Dead to determine final judgement.
Native American Judgement
The lore of several of the tribes of the great planes shows a bridge between this life and the next, The Bridge of Souls. Below that bridge is an abyss of darkness that consumes souls into its nothingness. Upon that bridge is a guardian, sometimes an Owl Woman, who looks at the spirit of those who would pass. If she recognizes that spirit as being kith or kin, deserving of the afterlife, she allows them to pass. If she should not, they are thrown from the bridge into the abyss.
Islamic Judgement
At birth, every person receives a Katib (writer) who throughout a person’s lifetime keeps tracks of all actions and inaction and writes those deeds in the kitab, the book of deeds. On the day of one’s death, the kitab is read to the recently released soul, and his or her final disposition is determined by its contents.
Why This is important to Wicca
Wicca is a modern religion, so one might say we can pick and choose what Pagan lore we desire and what we do not. While this is true, in asking what Wicca is we see guidance in what to choose and what not to. In looking at what Wicca is, we see a clear reason to recognize both a Summerland and a Winterland. You see, this book began with the separation of Light and Darkness, with the separation of Winter and Summer and that is how it will end, with Light and Darkness as well as Winter and Summer, in their reunion, in that which is the very end of the world.
You see, all things have a beginning, middle, and an end. We are all born, we all live, and we will all die. Our world was born, it is living, and it will die. We can extend our lives by living right and taking care of ourselves. We can extend our world’s life by taking care of it. But in the end, we will die. In the end, our beloved world will die as well. In the end of our life, our birth (Light) and our death (Darkness) will meet and cancel each other out. In the end of the world, Summerland will meet Winterland and cancel each other out. In the end of Divinity, the Gods will meet the Outsiders and cancel each other out. So one is left with two potential ways of looking at things:
1. How one lives does not matter because one will surely die.
2. How one lives is the only thing that matters because one will surely die.
You were born of Summer and Winter
Then reborn of Earth and Sky
This is your blessing and your fate
That one day you will surely die
The Death of the World
1 - 1 = 0
Thinking about the end of days is so distasteful that, to date, I do not recall ever reading of such matters in a book about Wicca. As Pagan lore is filled with such matters and as Wicca sees a beginning, middle and end to all things, one would think mention of the end of the world might be included. After all, if we do not recognize that as a potential, why would we fight against it? If one does not believe we may one day cause the extinction of all living things on this earth, why bother to fight against that eventuality? So then, incorporated into our lore we do see and end of all days just as surely as we see an end of our days.
Ragnarok (Also known as Gotterdammerung or ’Doom of Gods’)—Northern European
From the time of Ash and Elm, the Valkyries, Choosers of the Slain, have circled the world for the Einherjar, those who in life battled the Outsiders and in death have gone bravely. The Valkyries find these brave souls and bring them to the hall of Odin. Called Valhalla, the Hall of the Slain, it is not a place where the brave will live forever as the movie adaptation of the Norse Prayer suggests. It is a place where the Einherjar train for Ragnarok, the doom of the gods. It is a place where the brave are brave, not because they are promised immortality but because that is what they do and that is what they will do until the very end.
The Winter Fimbulvetr will mark the beginning of that ending. It is the Winter of all Winters, lasting three years with no summer between. All the earth will be blanketed with ice and snow. Battles will break out between nations as well as between kith and kin. Everywhere there will be war. A wolf named Skoll will consume the sun. His brother Hati will devour the moon. The stars will dwindle away, fading to sky that is nothing but black. Day will become as night, and night will become darker than any man can remember. The morning will be known only by the crow of three cocks. The cock named Fjalar will wake the Outsiders, those who have challenged the gods and lost. The cock named Gullinkambi will wake the Gods and a third cock will wake the dead.
The Outsider Jormungand, the great serpent, will rise from the sea and move towards land. In his wake, the oceans will swell, letting slip the ship Naglfar. In his wake will the land quake, letting slip the bonds of Fenrir. The Earth and sky will turn to poison in Jormungand’s wake. Hymir will sail the Naglfar, the ship of the Outsiders, to Vigrond. So too will come the slain of Hell in a ship sailed by Loki. And from Muspel in the south will come the Outsiders led by Surt, the fire giant. With him, Surt will bring a sword of flames that will scorch the Earth. Heimdall will sound the alarm, calling forth the sons of Odin and the Einherjar. They will come from the four corners of the world. Those who would stand with the Gods and those who would stand with the Outsiders, all meeting at the place of this, the final battle.
Odin and Fenrir will first meet, then Thor and Jormungand, then Heimdall and Loki. Though Freyr is unarmed, Surt will kill him without hesitation because that is what the Outsiders do. Though Tyr has but one arm, he will join the battle and attack Garm because that is what the Gods do. Thor will defeat Jormungand, but then himself die from its poison. Surt will kill the unarmed Freyr. Loki and Heimdall will kill each other, as will Tyr and Garm. Fenrir will swallow Odin and at the moment of Odin’s death, when it seems clear to both sides that all is lost, Vidar and Surt will show one last time the difference between the Gods (good) and the Outsiders (evil).
With his father and friends dead and nothing to be gained but his own death, Vidar will leap at his fathers killer and ripe the jaw of Fenrir from its skull, killing Fenrir to avenge his fathers death, knowing very well that not retreating from the battlefield meant his own death. Why will he do this? Because that is what the Gods do. But that is not what the Outsiders do. When Surt, who kills the unarmed, realizes he will not win, he swings his flaming sword to the four Quarters, setting the world on fire such that all will lose—the armed, the unarmed, the combatants, the non-combatants. Why will he do this? Because that is what the Outsiders do.
Shortly after the fires have consumed all that is left of the Earth after the great battle, the land will sink into the ocean and there will be nothing left of that which we have loved so dearly. The Gods will seem dead, Humanity will seem dead, and the Earth itself will seem dead.
So tell me? Who are you? Are you one of the Gods or are you one of the Outsiders? This too is the meaning behind the Wiccan greeting ’Thou art god’ and ’Thou art goddess.’ No, Ragnarok has not fallen. But the Valkyries are circling overhead and the Fenrir is scratching at the door. Some might argue that it is too late, but it is never too late to decide who you are. That and not what you have read here or in any other book on Wicca is the mystery of Wicca. That single question and the things that we do to try and answer it: Who are you?
But with the passing of time, a new world will rise from the ocean and the floods will recede. The Gods will be reborn and two of Humanity’s finest will have survived. Lif (’life’) and Lifthrasir (’eager for life’) will become as Ash and Elm, or maybe they are Ash and Elm. Maybe Ragnarok has already come and gone. Maybe it has come and gone many times over. Maybe it is a distant tale of our future, or maybe Fenrir scratches at the door even now. Do you see the Valkyries overhead? Are we at the beginning or the end?
In the glory of our Lord and Lady, the end becomes the beginning and the beginning becomes the end. So mote it be.
Chapter Dedication
This chapter is dedicated to Damien Echols and for anyone with a heart:
Damien, if you are innocent and there is nothing I, or those I rally, can do to prevent the unjust taking of your life, then I urge you to spend each moment between now and the moment of your death living as you have for the last 10 years. I urge you to meet your death in the way I feel a Wiccan would—in the unyielding battle to see that thy will be done. Thou art God!
Now manifest thy destiny in accordance with thy will!
To anyone with a heart. There is a distinct chance this man will be put to death for little more than his involvement in the Wiccan religion. I am not going to tell you that he is innocent, but I do think it is our responsibility as Wiccans to investigate the matter. If he is guilty, then you have waster a few minutes of your time. But if he is innocent, the Burning Times have returned and the fires are being lit in Arkansas.
The difference being this time you might be able to do something about it. Please visit www.damienechols.org.

Liber ab Clementia
(Book of Humanity)
The Third Order of Life
Study Material for the Third Degree
Of all the material presented herein, the title of this chapter is bound to be the most controversial. If we are discussing God and Goddess forms, why would I call this the Book of Humanity? Because it reflects the secret found in the three orders of life. You see, whatever you call our Lord and Lady, they are the sum total of all that lives. They are in essence, Life itself. Thus this book, the Book of Humanity, is the book of viewing our Lord and Lady alive in all humanity.
Ultimately, though we might be seen as worshipping our Lord and Lady by outsiders, the educated Wiccan knows that what is really being celebrated is Life and its splendor of diversity. This is why the Wiccan respects all order of plants, all order of animals, and all order of humanity. Black, red, white, yellow, or any variation between, in their many forms our Lord and Lady are us in our many forms. Like us, they started in Africa and circled the world to return and once again be united in the love in which they started, separated for the sake of union.
Here we find the Wiccan greetings: Thou art Goddess and Thou art God. Where we look to plants and animals as the creation of our Lord and Lady, here we have become God and Goddess in giving form to our Lord and Lady. No, we did not create them. But we have surely assigned them the many names and many forms by which we now recognize them.
Like any discussion of lore, this book is not complete in any sense of the word. Were it possible to create a complete reference, such a manuscript would fill the shelves of many libraries. Whenever possible, I have used the most current and credible reference material to expand and make corrections on the lore that has made its way into my Book of Shadows. However, with ongoing studies into these matters, reference material becomes outdated quickly. Making matters even more confusing, the same story told several times becomes different. In preparing this material, there were many instances where mythology provided two, three, or even more sets of parents/lines for a particular god or goddess. In those cases, I choose the lineage that not only seemed most current in academic reference but also the one that fits the underlying story presented by the whole of the line. That is, I have set my focus more on the relationships of the gods and goddesses rather than on individual deity forms.
We have traveled so many miles since our exodus from Africa. Along the way, we left behind pockets of humanity who developed unique cultures. But our journey has not been only along the coastlines and up through the Fertile Crescent. Our journey has not been only across land and over sea. It has also been a journey of time. As we migrated, those pockets of humanity grew into elder communities. Some of those communities prospered and grew. Others reached a peak and then fell from sight to be replaced by a different community in the same corner of the world. Other communities merged and mingled, sometimes as the result of war. Other unique cultures have been referred to as if they were one and the same for so long that folk have started to believe they are one and the same.
What is important in these matters is to remember that although we have been separated by both distance and time, we are one people. We are the children of Ash and Elm, who were themselves the children of Summer and Winter as well as Sky and Earth. This is why we can look to the many deities, separated by great distances of both land and time and see the same archetypes over and over again. To illustrate that point, I have diverged from the typical method of identifying the names of our Lord and Lady. Where most books list only the community who praised the deity, I have listed the general part of the world where that community is found. In so doing, I preserve the common reference to community in the context of the discussion of each particular deity, but I add the additional generalized geography of each as well. When I say generalized, I mean just that. Because I know that Ireland is not part of Central Europe, when listing the names of our Lord and Lady of Ireland, I include that reference in the context of those deities. However, I also note that when it comes to cultural migration, Ireland is part of Central Europe. After all, it is Irish lore itself that states the Irish people moved into Central Europe after the Great Flood and only later into Ireland.
Where cultures have moved about and intermixed enough that I can not be comfortable placing them with one migration or the other, I have listed the ones that seem most likely with respect to lore, elder science, and the newer science of mitochondria DNA. It is my hope that by doing so, I have illustrated that the many archetypes of our Lord and Lady are a matter of human migration (the general references) more than they are a matter of individual cultures (the contextual references) because I feel very strongly that these archetypes belong first to the world but that understanding their
contextual basis helps us in their understanding. To that end, I identify the world as in the following diagram:

Homes of Our Lord and Lady
The Cultural and Geographical Names of Our Lord and Lady
Abraxas—Male—Middle East/Mediterranean Animal association: Chicken, Horse (white)
Potentially an ancient Gnostic name used in place of the unspeakable name of the Supreme Being and to identify that being with solar energy. His name sometimes appears in reference by the medieval demonologists, but their opinion was obviously biased. His name is the most likely origin for the expression abracadabra, perhaps indicating the idea that with the Creator all things are possible. I say potentially because there is a distinct possibility this is a very modern myth.
Acat—Male—Central America
Mayan and Yucatan people prayed to Acat for healthy children. Acat was seen as a god of human development, shaping our children in the womb. He has been adopted by tattoo artists as patron deity.
Acca Larentia—Female—Mediterranean
(Also known as Lupa)
Husband: Faustulus
Lover: Hercules
Animal association: Wolf
In one version, an Etruscan goddess who adopted Romulus and Remus. Another version states that she is one of Hercules’ lovers who is particularly promiscuous. In that aspect, she is sometimes either called or associated with the name Lupa. There she is seen as a charitable goddess, having married rich and upon her husband’s death gave her inherited wealth to the citizens of Rome when they were in need.
Achelous—Male—Mediterranean
(Also known as Acheloos)
Father: Oceanus
Mother: Tehys
Lover: Melpomene
Animal association: Cattle (bull), Snake (serpent)
’He who washes away cares’ —Greek god of the river by his name as well as other flowing bodies of fresh water. So much did he love Deianeira, that he wrestled with Hercules for her hand in marriage. He lost not only the competition but his arm. Sometimes cited as son of Helios and Gaia
Achilles—Male—Mediterranean
(Also known as Achilleus)
Father: Peleus
Mother: Thetis
’Lipless’—Greek god who warns that we are all vulnerable. From his story, we have the expression “Achilles Heel.” His mother, Thetis, did her best to protect him from harm, dipping him in the River Styx so that all parts of his body which contacted the water would be invulnerable. To his downfall, Thetis had held him by his heel when dipping him into the water, leaving a vulnerable spot. Achilles fell when his heel was struck by an arrow shot by Paris at the Trojan War. Although he fell during that war, he was one of its greatest heroes.
Achlys —Female—Mediterranean
’Darkness’ or ’Dark mist’—Greek creator who gave birth to the creator Chaos. Her name shows a clear link to the story of Diana (Darkness) giving birth to Lucifer (Light) and the story given in the Book of Genesis.
Anchises—Male—Mediterranean
Father: Capys
Lover: Aphrodite
Roman mortal who did so love the goddess Aphrodite that she welcomed him to her bed and bore him a son, Aeneas. He was the owner of six incredible horses which he created by mating his own mares with six divinely bred stallions.
Adam—Male—Middle East
Father: Yahweh
Mother: Earth
Wife: Lilith, Eve
Although often cited as the Christian first man, even Christian scripture is rather clear that he was not. First Yahweh created life with Mother Earth: “Let the Earth bring forth the living creature after his kind..” (Genesis 1:24). Later, the line of humanity is created (presumably with the help of Mother Earth): “Let us make man in our image, after our likeness” (Genesis 1:26 ). After the week long process of creating not only Earth and sky but all the creatures of land, sea, and sky, after his rest on the seventh day, then God created Adam: “And the Lord God formed man...” (Genesis 2:7). But the creation of Adam was not without argument. After Yahweh told the angels that he had intended on creating Adam, he ordered them to bring to him clay from which he would sculpt Adam such that another line of humanity would follow. They strongly advised against the action, stating; “Humanity in the line of Adam will hatch hatred, jealousy and sin, he will light the brush-fire of war.” So too did Mother Earth disagree at first, stating that ’No part of mine will be used to form a disobedient sinner.” Although Mother Earth objected to the creation, Yahweh sent Azrael, the Angel of Death, to rob her of the clay necessary to create Adam, in effect bringing Adam into this world through an act of rape. That rape is the ’original sin’ for which Yahweh would later suffer as Jesus Christ to wash away. See Jesus.
Adamah—Female—Middle East
Hebrew personification of the Earth, perhaps the victim of rape at the order of Yahweh. See Yahweh.
Adapa—Male—Mediterranean/Middle East Father: Ea
Mother: Kishar
Babylonian god sent by his father to protect and watch over humanity. Paris (God) offered Adapa immortality for humanity, but
Adapa refused. He reminds us that it is not always in our children’s best interest to give them what they desire. In another story, he did not receive immortality because he did not conduct himself as would a god.
Addad—Male—Mediterranean/Middle East (Also known as Iskur [Sumerian]) Animal association: Bull, Dragon (lion)
Babylonian god of rain and storms.
Adibuddha—Male—Near East
The Buddhist embodiment of the masculine principle of the Buddhist soul.
Adereosa—Female—Africa/Middle East
(Also known as Adra Nedega [Babylonian])
Egyptian and Arabian virgin who is seen nursing her child in the night sky as the constellation Virgo.
Adra Nedega—See Adereosa
Aditi—Female—Near East
Lovers: Brahma, Kashyapa
Animal association: Cow
’Limitless,’ ’Free from bonds,’ or ’The un-bound’—Hindu All Mother and sky goddess. Mother of the Sun (Mitra) and Moon (Varuna), which together define the solar year and the months of that year. She gave birth to the twelve Adityas, each associated with one of the Hindu 12 months of the year. See Adityas.
Adityas, The—Male—Near East
Father: Kashyapa
Mother: Aditi
Twelve Hindu sun gods associated with the 12 months of the year. They are: Vishnu, Aryman, Vivasvana, Amshumana, Parjanya, Varuna, Indra, Dhatri, Mitra, Pusha, Bhaga, and Tvashta. Alternatively, the Adityas are sometimes cited as: Ansa, Aryman, Bhaga, Daksha, Dhatri, Indra, Mitra, Ravini, Savitri, Surya, Varuna, and Yama.
Adoni—Male—Mediterranean/Middle East
Phoenician/Babylonian consort (lover) of Astarte, Adoni is associated with the waxing and waning of the solar year. A god of the green, Adoni was seen as dying at the onset of Winter and being reborn with the new Summer.
Adonis—Male—Mediterranean
Lover: Aphrodite, Dionysus
Animal association: Dove, Boar, Lion, Plant association: Acacia, Adder’s Tongue, Anemone, Bay, Corn, Daffodil, Fennel, Heather (especially white), Jojoba, Lettuce, Vine (grape), Lily, Myrrh, Olive, Rose
’Lord’—Greek patron of children, virgins, and anyone that feels alone or lost in the world. As one of Dionysus’ male lovers, he has become one of the patrons of the gay, lesbian, and bisexual community. His holiday on July 19th is associated with his relationship with Aphrodite. So much did Aphrodite love Adonis that she begged him to give up hunting, but it was his favorite sport, so he refused and continued. Again she begged him, but he would not give up the pleasure of the sport of hunting. Eventually, just as she had worried, he was killed while hunting. A wild boar, who was Aphrodite herself, attacked and killed Adonis. From this I have taken the principle that when one has love in one’s heart one cannot make sport of death. Although hunting may be necessary for survival, there can be no love in the act. This reflects strongly on the principle put forth in the Book of Animals in respect to not naming kith familiars.
Incense Recipe
2 parts Myrrh (sweet myrrh is best)
1 part Bay Leaf
1 part Gum Arabic
1 part Rose petals (red) or 9 pomegranate seeds*
Enough Adonis or Myrrh oil to bind
*If being used during Winter (Samhain through Beltane), use pomegranate seeds. If you will be using during the Summer, use the rose petals.
Oil Recipe
9 drops Bay essential oil
6 drops Myrrh essential oil
6 drops Otto of Rose (or 3 drops Rose Geranium and 3 drops Cypress)
1/2 ounce Olive oil
Adraste—Female—Central Europe (Also known as Andrasta, Adraste) Animal association: Hare
Celtic goddess of war during the Celtic British rise against Rome.
Aeacus—Male—Mediterranean
(Also known as Aiakos and Aeacos)
Father: Zeus
Mother: Aegina
Animal association: Ant, Elephant
Plant association: Allspice, Aloe, Cinnamon, Frankincense
’Earth born’—The Greek Aeacus tells us that appealing to higher powers is sometimes necessary to overcome obstacles. He tells us that our word is our bond and reminds us that judgement is most certainly part of the Pagan mindset. By many accounts, he was conceived after Zeus raped his mother Aegina, he went on to rule Attica (the island Zeus had kidnapped his mother to). Aeacus was one of the three judges of the Underworld, determining one’s death based on how one lived.
Incense Recipe
3 parts Frankincense
3 parts Allspice berries
1 part Cinnamon
Enough Aeacus or Frankincense oil to bind
Oil Recipe
9 drops Frankincense essential oil
9 drops Allspice essential oil
3 drops Cinnamon essential oil
1/2 ounce base oil
Aeetes—Male—Mediterranean
(Also known as Aietes)
Father: Helios
Mother: Perse
Greek king of Colchia, son of Helios, and father of the sorceress Medea.
Aegina—Female—Mediterranean
Mother: Merope
Lover: Zeus
Greek woman who was kidnapped by Zeus as a girl, brought to the island Attica, and some say raped. As a result, she bore Aeacus who later ruled the island.
Aegir—Male—North Europe
Wife: Ran
Animal association: Fish and to some degree all creatures of the sea.
Norse god of the sea. Aegir speaks to us of human adoption, telling us that blood is not nearly as important as heart.
Aello—Female—Mediterranean
(Also known as Podarge [’fleet foot’])
’Swift Storm’ —Greek Harpy charged with creating peace. In that capacity, she and the others are beautiful winged maidens (sometimes virgins). But to keep that peace, she and the others were also the punishers of crime. In that capacity, they are horrid winged beasts. One of the three Harpies. The other two are Celaeno and Ocypete.
Aeneas—Male—Mediterranean
(Also known as Aineias)
Mother: Venus
Father: Anchises
Roman mortal born of the goddess Venus. Aeneas is the founder of the Roman nation and patron of interracial/cultural couples. Sometimes cited as son of the Greek goddess Aphrodite.
Aengus Mac Og—Male—Central Europe (Also known as Angus, Anghus, Aonghus, Angus Og, Angus Mac Og, Oengus Mac Og)
Father: Dagda
Mother: Boann
Plant association: Hazelnut, Heather, Witchhazel
’Angus the Young’—Irish god who speaks to us of trickery and the ability to outsmart an opponent.
Incense Recipe
2 part Heather Flowers
2 part Gum Arabic
· 1 part Witchhazel
Oil Recipe
Simmer Witchhazel and Heather flowers in Hazelnut oil, strain, and cool. This is not a strongly scented oil; if you want to scent it add a few drops of Heather scented oil after it cools.
Aeolus—Male—Mediterranean
(Also known as Aeolos and Aiolos)
Father: Poseidon
Mother: Arne
Wife: Gyane
’Earth destroyer’—Greek and Roman god associated with the winds. He invented sails and is thus associated with sea travel.
Aestas—Female—Mediterranean
Roman goddess of Summer.
Aesir, The—Male/Female—North Europe
Scandinavian tribe of Norse gods and goddesses who live in Asgard and initially battled the Vanir. The conflict was eventually settled, and the Aesir and Vanir allied. The allegiance of these two tribes may be found in the marriage of Odin (Aesir) and Frigg (Vanir).
Aganippe—Female—Mediterranean
’Mare who kills with mercy’—Greek nymph who is associated with fresh-water springs and the wells that they fed.
Aganyu—Male—Africa/Caribbean/South America
(Also known as Aganju)
In Santeria, he is called Aganyu-Sola.
In Voodoo, he is called Aganyu.
Wife: Yemaya
Holiday and Saint associations: Feast of Saint Christopher on July 25th, Feast of Saint Michael of Assisi on October 4th
Yoruba god of all Earth forces, especially volcanoes. In blending with the Catholic tradition, he became associated with Saint Christopher and to a smaller degree with the Archangel Saint Michael. He is called on to aid in control over baneful influences but only with Shango’s intercession in much the way Christians look to the Father God for help through their Christ.
Agarou Tonerre—Male—Africa/Caribbean
Haitian Voodoo sky and thunder god.
Agassou—Male—Africa/Caribbean
(Also known as Ati-A-Sou)
Father: Agwe
Animal association: Panther
Originating as an African panther god, Agassou became the Haitian Voodoo loa of family/cultural traditions, as well as natural springs. He is the keeper of secret traditions and the guardian of ancient ways.
Agathos Daimon—Male—Africa/Mediterranean (Also known as Agathadaimon [Egyptian]) Animal association: Snake (serpent) Plant association: Rice
’Good spirit’—The personification of luck and of all things pleasant. Often cited to the Greeks as Agathos Daimon. He is sometimes cited as Egyptian Agathadaimon, probably migrating with cultural exchange. He is honored in connection with ancestral sprits. Offerings commonly made to Agathos Daimon commonly include flowers, rice pudding, honey, and butter.
Agayu—Male—Africa/Caribbean
Catholic Saint association: Saint Christopher Holiday: Feast of St. Christopher on July 25th
Santeria patron of travelers. He protects all forms of travel, including air and water.
Agdistis—Male/Female—Mediterranean (Also known as Agdos)
Father: Zeus
Mother: Cybele
When Zeus discovered Cybele hiding from his pursuit, he raped her. In so doing he brought about the conception of Agdistis, a hermaphrodite.
Aglaurus—Female—Mediterranean
(Also known as Aglaulus)
Greek woman who was told by an oracle that if she sacrificed herself, she would end the siege on her city, Athens. Upon being witness to her sacrifice, the siege was ended by the invading forces. Today, her name is what many Wiccans think of when swearing the oath upon joining the military. In time of old, young men joining the military to protect Athens did so in her name.
Agenor—Male—Mediterranean
Father: Poseidon
Lover: Telephassa
’Very Manly’—The King of Troy who, when his daughter Europa was kidnapped by Zeus, sent his sons to recover her. His story speaks to us of fathers passing family duty (dharma) to their sons.
Aglaia—Female—Mediterranean
Father: Zeus
Mother: Euronyme
Husband: Hephaestus
’The brilliant and shinning one’—The youngest of the Three Graces found in Greek lore. Her parents are sometimes cited as Dionysus and Aphrodite. See also Euphrosyne and Thalia.
Aglibol—Male—Middle East/Mediterranean
’Messenger of the Lord’—Ancient Syrian (pre-Islam) sun god who forms a sacred triad with Bel and Yarhibol.
Agloolik—Male—Arctic North America Animal association: Seal
Agloolik is prayed to for good fortune while hunting in cold weather. He is believed to live under the ice and lend assistance to hunting only when needed. Calling on him to assist in sport hunting provokes a baneful response, such as hunting accidents.
Agnayi—Female—Near East
Husband: Agni
Hindu fire goddess. She is prayed to by women when seeking sudden and irreparable change, often for revenge, especially of rape and abuse. Note that the reference to her husband is often disputed. Sometimes her name is said to be a female aspect (not wife) of Agni. See Agni.
Agni—Male—Near East
Father: Dyaus
Mother: Prithvi
Wife: Agnayi
Lover: Shiva, Svaha
Animal associations: Cattle (bull), Eagle, Goat, Horse, Ram
Plant associations: Dragon’s Blood, Red Poppy, Hibiscus, Nettle (greater), White Poppy
Hindu fire god. His wife is most often listed as Agnayi, sometimes as Ushas (his sister), and sometimes his wife is cited as being his lover Svaha. I believe the name ’Svaha’ could be a deliberate attempt to rename Shiva and thus cover the homosexual exchange between Agni and Shiva. Although most often considered heterosexual, a story survives that states Agni once swallowed Shiva’s semen. But even with that story, there is not reference to it being a lustful act. He is also god of lightning, storms and rain. He is one of humanity’s benefactors in fertility, bringing rain to crops and the lightning that caused all life to propagate (see the Book of Genesis). One of the eight Hindu guardians of the principle directions. Agni is the guardian of the South East. The other seven are Indra, Yama, Surya, Varuna, Vayu, Kubera, Soma.
Incense Recipe
· 2 parts Hibiscus flower
1 part Nettle
1 part Gum Arabic
1 pinch poppy seeds
Enough Agni or Dragon’s Blood perfume oil to bind
Oil Recipe
9 drops Allspice essential oil
6 drops Frankincense essential oil
3 drops Cinnamon essential oil
1/2 ounce base oil
Agunua—Male—Polynesian Islands
Animal association: Snake (serpent)
Solomon Islands serpent god. Sometimes seen as a supreme god with the other gods and goddesses of the islands just aspects or personalities of Agunua. The first seasonal fruit of each tree is made sacrifice to him.
Agwe—Male—Africa/Caribbean
Wife: Erzulie (La Sirene)
Haitian Voodoo god of fish, sea plants, and to a lesser degree of the ocean itself. Sacrifice is made to him to insure a good harvest of fish and sea plants. Those offerings are cast into the ocean with the hopes that they will be returned in the harvest.
Ah—See Aha
Aholibah—Female—Middle East
Husband: Yahweh
Originally a Hebrew All Mother, wife to Yahweh. After creating all of humanity except Adam and Eve, she and Yahweh had a falling out. Humanity took her side in the matter, so Yahweh went on to create his own group of humanity in the Garden of Eden, who would follow him blindly. See Yahweh. She was later called the ’voluptuous whore’ and still later the ’menstruating whore’ by the line of Adam and Eve and virtually removed from their lore. Now is that any way to treat a lady?
Ahriman—Male—Middle East/Mediterranean (Also known as Angra Mainyu (’fiendish spirit’), Ako Mainyu)
Father: Zervan Akarana
Animal associations: Cat, Jackal, Wolf, Frog, Iguana, Lizard, Salamander, Snake (serpent), Toad
Note: Listed with masculine association due to modern convention. The original early Persian use of the word was feminine.
Perhaps the origin of the contemporary Christian concept of Satan. Although the name Satan most certainly comes from the earlier word for antagonist, the concept of an all evil antagonist to the Christian God did not come into play until the Persians were invaded by the Indo-Europeans. It is likely that the invasion resulted in mingling of the lore behind the antagonist and this entity, which was seen by the early Persians as being the leader of evil who is in opposition with Ormazd (good). It was Ahriman who led Mashia and Mashiane away from Ormazd, which is probably at least a contributor to the better known story of Adam and Eve.
Ahsonnutli—Male/Female—North America (Also known as the Turquoise Hermaphrodite)
Ahsonnutli is the Navajo creator of both Heaven and Earth. One can easily see the connection that can be made to the Nameless One in the creation story given here. But there is another important message given by Ahsonnutli. Seen variously as hermaphrodite and as bisexual, Ahsonnutli demonstrates yet again that any modern Pagan religion should welcome folk of all sexual preferences, as the ancient Pagans certainly did.
Ahti—See Ahto
Ahto—Male—Central Europe/North Europe (Also known as Ahti)
Wife: Vellamo
Finnish god of the sea, the shore, and all creatures which reside therein. He is also god of physical strength who is prayed to for assistance in overcoming attack, threat, or for accomplishing a task which tests the limits of both strength or endurance.
Ahura Mazda—Male—Middle East
(Also known as Ormazd, Ohrmazd, Ormuzd) Father: Zervan Akarana
Son: Atar
Animal association: Hawk
’Lord Wisdom’—Persian personification of good. He created the first man, Gayomart, who died and from whose body came the first Couple. Ahura Mazda was then God of the first human couple; Mashia and Mashiane. In opposition to Ahriman (evil).
Aine—Female—Central Europe
(Also known as Aine of Knockaine)
Father: Eogabail
Animal association: Cattle, Horse
Irish moon goddess who watched over crops and cattle as their caregivers slept. She is often cited as a goddess of love and fertility, sometimes as a fairy queen. Patron of farmers and domesticated animals, especially cattle.
Airmid—Female—Central Europe
(Also known as Airmeith)
Father: Dianchecht
Irish goddess of healing and health. Patron of herbalists.
Aizen Myoo—Male—Far East
(Also known as Aizen Myo’o)
Japanese Buddhist lion-headed god of love who watches over humanity, offering help when needed. Patron of all of humanity, but particularly of prostitutes and musicians.
Aji-Suki-Takahikone—Male—Far East Father: O-Kuni-Nushi
Japanese god of storms, particularly thunder.
Aker—Male—Africa
Animal association: Lion
An Egyptian personification of the Earth and thus, god of the dead. Aker opens the gates to the Underworld.
Akaru Mime—Female—Far East
Japanese patron and protector of sailors.
Akibimi—Female—Far East
Japanese goddess presiding over Autumn (days between Fall Equinox and Winter Solstice).
Akka—Female—North Europe
(Also known as Yambe-akka)
Husband: Ukko
Holiday: Honored on July 15
Finnish goddess of the Underworld. Sometimes cited as Earth Mother.
Akna—Female—Arctic North America
Husband: Akanchob
’The Mother’—Eskimo goddess of childbirth and patron of both mother and child.
Akupera—Male—Near East
Animal association: Tortoise
Hindu tortoise god who supports the Earth on his back.
Alaghom Naum—Female—Central America (Also known as Alaghom Naom Tzentel) Husband: Patol
’Mother of Mind’—Mayan goddess and creator of human consciousness.
Albina—Female—Mediterranean
Plant association: Barley
Tuscan goddess of the dawn, of particular note in the lore of Tuscan Witches. Sometimes cited as a barley goddess.
Alcippe—Female—Mediterranean
Father: Ares
Greek goddess who was raped by Halirrhothius. See Ares.
Alcmena—Female—Mediterranean
Husband: Amphitryon
Lover: Zeus
Greek goddess who was condemned by her husband Amphitryon to burn to death as punishment for her infidelity with Zeus. Zeus saved her from that end.
Alecto—Female—Mediterranean
’Unceasing Anger’—Greek goddess of justice and vengeance. One of the three Erinyes. The others are Megaera and Tisiphone.
Aleion Baal—Male—Middle East
(Also known as Aleyin, Aleyn) Father: Baal
Animal association: Boar and to some degree all creatures of the wild.
Phoenician god of Spring and of the weather necessary for abundant crop growth.
Alektraon—Male—Mediterranean
Animal association: Chicken
Greek deity hired by Ares to watch over Aphrodite as she slept and when Ares was parted from his love.
Aleyin—See Aleion Baal
Aleyn—See Aleion Baal
Alignak—Male—Arctic North America/North America
(Also known as Aningan)
Inuit/Eskimo deity who was banished on a charge of incest. After being banished, he became the Moon and his sister became the Sun, forever circling their home but never being allowed to return or again to be with each other. Their chase is responsible for earthquakes and weather changes. Their rare reunion is the solar eclipse. While some might joke that the moral of this story is sleeping with your sister will make you a god, the more practical observation is that where the earlier gods and goddesses were often seen as incestuous, the later developing deity forms stood clearly against such matters. I believe this shift was due to medical observations made on the dangers of incest. Like Jewish dietary law, religious taboo against incest came about due to entirely pragmatic concerns.
Allah—Male—Middle East
Wife: Allat (also daughter)
’The God’ (derived from ’al-ilah’)—Persian and Arabian All Father. Allah is to Islam what Yahweh is to Christianity. What is commonly called Islam today would better be termed Mohammedism because today’s Islam reflects mainly on the teachings of Mohammed. It is interesting to note that of the worship of Allah, Mohammed saw both Jews and Christians as all worshipping Allah by different names, calling both Jews, Christians, and Moslems “Children of the Scripture.” The primary difference is that neither Jesus nor his mother were viewed as being themselves part of divinity. Prior to Mohammedism, Allah was an Arabic Creator but not the one and only god as promoted by Mohammed’s declaration. When we consider the recent and ongoing actions of fundamental Islam, we see the effects humanity receives for giving name to the Nameless One. Allah is said to have three daughters: Allat (also his wife), Menat, and Al-Uzza. Together, they make the Triple Goddess who is often known by the name of his wife and one of the daughters, Allat.
Allat—Female—Middle East
(Also known as Allatu and Al-lat) Father: Allah
Husband: Allah
Holiday: New Moon
’The Goddess’ (derived from ’al-ilat’)—Per-sian and Arabian All Mother who was condemned by the followers of Mohammed the same way the wife of Yahweh was condemned by the line of Adam and Eve. However, she later appears as one of Islam’s three daughters of Allah. This was perhaps a Mohammedan attempt at hiding her significance as Allah’s equal. Her holiday is the New Moon, but the cycle of the waxing moon is also sacred to her. She is one of the many Triple Goddesses, her other names being Al-Uzza and Menat.
All Father—Male—Universal
Most often used as a name for Odin, the term has been used so universally prior to the modern Pagan movement that it is used almost interchangeably with the Neo-Pagan term Sky Father.
All Mother—Female—Universal
Most often used as a name for Gaia, the term has been used so universally prior to the modern Pagan movement that it is used almost interchangeably with the Neo-Pagan term Earth Mother.
Alphaeus—Male—Mediterranean
Lover: Arethus
Greek river god who fell in love with the nymph Arethus.
Aleitheia—Female - Middle East/Mediterranean
’Truth’—Gnostic Aeon of experienced truth and the hidden meaning behind the mystery. She is that which cannot be expressed in language either written or spoken, but that which must be experienced to be understood. She is often expressed with a sexual undertone, as if to say the reception of the truth behind a mystery is the act of experiencing orgasm within her embrace.
Althaea—Female—Mediterranean
Husband: Oeneus
Lover: Dionysus
Greek goddess of birth and, to some degree, of plant growth. A couple can call on her favors by sharing wine with the Earth as sacrifice. To do so, become skyclad with your partner outdoors on a slightly chilly night and share a bottle of grape wine, giving one drink to the potential father, one to the potential mother, and then one to the Earth (spill it to the ground). Repeat until you have consumed that which you intended and then make love outdoors where you made the offering. View your lovemaking to be an offering itself. Be aware that although filled with maternal instinct, she is not without limits. When her son Meleager was born, it was prophesized by the Three Fates that he would live only as long as a particular ember in the fireplace remained unconsumed. She immediately grabbed that ember from the fire, extinguished it and hid it to insure it never be burned. As an adult, Meleager killed his mother’s brothers. In response, Althaea returned that ember to the fireplace, thus bringing about her own son’s death.
Al-Uzza—Female—Middle East
Father: Allah
Holiday: Full Moon
An aspect of the Triple Goddess Allat. She is goddess of the morning star. See also Allat.
Amalivaca—Male—South America
Venezuelan god who taught man the arts of farming and negotiating with Nature.
Ama-No-Minakanushi-No-Kami—Male—Far East
Japanese supreme god and ruler of all other deities in his pantheon.
Amaterasu—Female—Far East
(Also known as Ama Terasu)
Father: Izanagi
Husband: Takami-Musubi
Animal association: Chicken (Cock), Crow
’She who shines in heaven’—Japanese Shinto sun goddess who rules the world with her husband Takami-Musubi. She banished her brother Susanoo, the moon god, from Heaven. Known to have a familiar named Yatagarasu who is a Crow.
Amathaon—Male—Central Europe
Plant association: Spikenard (ploughman’s) Father: Beli
Mother: Don
Welsh god responsible for causing the conflict between his brother Gwydion and Arawn, Battle of the Trees. Amathaon is a working man’s god. His name comes from the Welsh word amaeth, which literally translates to “ploughman.”
Amatsu-Mikaboshi—Male—Far East
(Also known as Ama No Kagaseo [’Brilliant Male’])
’August star of heaven’—Japanese personification and god of Evil. Similar to the Christian Satan.
Ambika—Female—Near East
Husband: Shiva
Hindu avatar/incarnation of Parvati as the creator and protector who transforms into the destroyer Kali. Her lust-inspiring beauty is her weapon. She first flirts with her enemy, telling them that she has sworn an oath never to allow anyone who has not bested her in combat into her bed or embrace. When fools take her up on her challenge, she uses words to defeat the challenger’s friends, leaving the challenger to battle her on her own. She then transforms into Kali and makes short work of the challenge. Her story is classically told as the destroyer of demons who first releases a hum that kills the attendants of the demons who challenge her and then transforms into Kali to finish off the demons themselves. Other citations state that she uncurls her tongue and tricks the demons onto it. After their slaughter, she consumes them and their demonic blood causes her to become Kali, full of rage. Her rage and/ or transformation into Kali is calmed when her husband Shiva throws himself at her feet. Unable to kill him, she then transforms back into Ambika/Parvati.
Ambisagrus—Male—Central Europe Celtic sky god and All Father figure, sometimes associated with the Roman Jupiter.
Ame-No-Oshido-Mimi—Male—Far East
Mother: Amaterasu
Japanese god who was offered rulership of the Earth by his mother. He took one look and refused the offer.
Ame-No-Wakahiko—Male—Far East
Wife: Shitateru-Hime
Japanese ruler of the Earth until he was killed by Takami-Musubi
Amergin—Male—Central Europe
Irish mythical bard and perhaps historic character reportedly responsible for the creation of the poem ’I am a stag of seven tines,’ which years later has been used to support the theory of the Celtic Tree calendar. (Per The Witches God, by Janet and Stewart Farrar, page 154.)
Am-Heh—Male—Africa
Animal association: Dog
Egyptian Underworld god with a human body but dog head.
Amphitryon—Male—Mediterranean
(Also known as Amphitryo)
Wife: Alcmena
’Harassed on all sides’—Greek general who found struggles at every step of his life. He fell in love with Alcmena and was wed, but his wife refused to (or could not) have sex with him until the death of her brother was avenged. While avenging that death, Zeus visited his wife’s bed, making her pregnant with the child that would grow up to be Hercules. On discovering her infidelity, he condemned his wife to burn to death. Fortunately, Zeus saved her at the last moment.
Amshumana—Male—Near East
Father: Kashyapa
Mother: Aditi
Amshumana is one of the Adityas. The Hindu month Asadha (June 22-July 22) is sacred to Amshumana. See Adityas.
Amun Ra—Male—African
(Also known as Amun Re, Amon Ra)
Wife: Mut
Animal associations: Bee, Donkey, Duck, Frog, Goose, Ram, Sheep
Plant associations: Acacia, Amaranth, Aloe, Cedar, Frankincense, Myrrh, Olive, Palm (date), Saffron (Spanish), Water Lily
Egyptian unification of the Theban god Amun and the later Egyptian god Ra.
Incense Recipe
2 part Sandalwood (yellow)*
1 part Frankincense
1 part Myrrh
* Alternatively, 1 part Yellow Sandalwood and 1 part Cedar
Oil Recipe
10 drops Sandalwood
5 drops Frankincense
5 drops Myrrh
1/2 Ounce Safflower Oil or Sunflower Oil
Amenti—Female—Africa
(Also known as Amentet)
Animal associations: Dog, Hawk, Hippopotamus, Ostrich
Egyptian goddess who welcomes the dead to the Underworld at its west gate where the sun sets. Her name is synonymous with that entrance, where Osiris judges the hearts of those who have died.
Amor—See Cupid
An—Male—Mediterranean/Middle East
Wife: Ki
Sumerian sky god, sometimes associated with the Babylonian Anu as if they were the same; however, the lineage does not add up well for that association.
Anagke—Male—Mediterranean
Greek goddess whose name means ’necessity’ but who is most often cited as a goddess of destiny. This speaks volumes about the ideas of dharma, will, true will, and free will.
Anahita—Female—Middle East
(Also known as Anaitis, Ardvi Sur, Aredvi Sura) Animal association: Horse
Holiday : Ten days prior to each New Moon.
Persian Water goddess whose holiday may be associated menstruation and the moon. After the Persians and Babylonian cultures mixed, she took on many of the attributes of Ishtar. Women’s virginity was sacrificed to her. To support her temples, virgins would serve as sacred prostitutes until such time as their virginity was accepted, at a price, by visiting men. Although this practice may well seem disgusting by today’s standards, the majority of those offering their virginity as sacrifice were from wealthy homes, went willingly, and received much training in the ways of physical love in exchange for their sacrifice.
Anait—Female—Middle East
Animal associations: Dog, Lion
Middle Eastern goddess who is sometimes identified with or described as being similar to the Hindu Annapurna. Other citations state that she was adopted by the Persian Ahahati.
Ananse—See Anansi
Anansi—Male—Africa
(Also known as Ananse)
Father-in-law: Nyame
Animal association: Spider
An Ashanti god who provided the material by which Nyame created the first human. He convinced his father-in-law, Nyame, to provide humanity with sun, moon, rain, and the other things necessary to farm, and later taught humanity the art of farming and negotiating with Nature.
Anatha Baetyl—Female—Africa/Middle East Husband: Yahweh
Animal association: Owl
One of two Hebrew wives of Yahweh from the fifth century b.c.e. following at Elephantine, Egypt. The other was Ashima Baetyl. See Yahweh.
Anatina—Male—South America
(Also known as Anatiwa)
Brazilian god who was responsible for the Great Flood.
Anatiwa—See Anatina
Andromeda—Female—Mediterranean
Father: Cepheus
Mother: Cassiopeia
Husband: Perseus
’Ruler of Men’—Greek woman who was made sacrifice to a sea monster sent by Poseidon. She was rescued by Perseus and became his wife.
Angana—Female—Near East
Lover: Kasari
’Handsome Woman’—Hindu goddess of beauty and self-worth. Mother of Hanuman.
Angra Mainyu—See Ahriman
Angurboda—Female—Northern Europe Lover: Loki
Animal association: Wolf
’Herald of sorrow’—Scandinavian giant who is sometimes seen by the Pagan community as a Crone Goddess. Called the ’Herald of Sorrow,’ she can be seen as a goddess of ill-fate. With her three monstrous children Fenrir, Jormungand, and Hel we see again that three is the number of not only good fate but of ill-fate.
Aningan—See Alignak
Anna Perenna—Female—Mediterranean
Plant association: Barley
’Eternal Steam’(from amnis perennis)—Ro-man goddess of the solar year with a slightly heightened focus on the Light half. She has often been called the ’Grandmother of Time’ as a reflection on her role in the Roman year, as well as her Crone position in the three stages of life. She is often cited as being associated with food or the harvest; however, this may be an association that came from confusing her with the Hindu Annapurna. On the full moon of Martius in particular, but also at all full moons, she is celebrated with the sacrifice of barley cakes. Preparing these cakes for kith and kin on the full moon of Martius is said to bring good bounty during the remainder of the solar year.
Annapurna—Female—Near East
Hindu avatar/incarnation of Durga who presided over mountains and provides needed food to humanity. Sometimes confused with the Roman Anna Perenna.
Anpu—See Anubis
Ansar—Male—Mediterranean/Middle East (Also known as Anshar, Assorus)
Father: Lakhamu
Mother: Lakhmu
Wife: Kishar
Babylonian god. Father of many children, but most notably Anu and Ea.
Antaeus—Male—Mediterranean
Father: Poseidon
Mother: Gaia
Greek giant who was invincible in every way as long as he remained in contact with the Earth (Gaia, his mother). He was defeated by Hercules when Hercules picked him up off the ground, thus severing his ties with his mother and bringing his loss. This story speaks volumes to the connection between sons and their mothers.
Anteros—Male—Mediterranean
’Return’—Greek god of mutual love and the punisher of those who do not return love. Before his birth, his brother Eros was horribly lonely and depressed. So deep was Eros’ depression that Aphrodite took notice and gave him Anteros as brother and companion. Anteros speaks to us of not only brotherly love, but love that is returned in the manner in which it is given. He tells us that mutual love and admiration is far superior to one-sided desire, for even Eros (god of desire) was humbled before the feeling that he was alone.
Anat—Female—Mediterranean
Husband: Anu
Babylonian goddess and mother of Ishtar.
Angerona—Female—Mediterranean
Roman goddess of secrets who is always shown with a finger to her lips in the way a librarian might to hush you.
Anu—Male—Mediterranean
(Also known as Anum)
Father: Ansar
Mother: Kishar
Lover: Ki
Wife: Anat
Plant association: Tamarisk
’Great above’—In the Mesopotamian pantheon, he is king of the gods. An All Father figure and sky god. Not to be confused by the Irish goddess of the same name. He was called on by the Mesopotamian pantheon to mediate disputes between the other deities, who called him Father. Sometimes associated with the Sumerian An.
Anu—Female—Central Europe
Animal association: Cat
Irish goddess of war and one of the Irish Triple Goddesses of Fate. The other two are Badb and Macha. See also Morrigan. Not to be confused by the Mesopotamian/Sumerian/ Babylonian god of the same name.
Anubis—Male—Africa
(Also known as Anpu, Anup, Ienpw, Wip, Yinepu)
Father: Osiris
Mother: Nephthys
Animal associations: Cock, Jackal
Plant associations: Benzoin, Poppy (especially white), Sandalwood (yellow)
Sometimes cited as son of Set. Egyptian jackal-headed god who was born by Nephthys but later adopted by Isis. When Horus’ body was scattered by Set, it was Anubis who helped his adoptive mother Isis reassemble his body, thus resurrecting him.
Incense Recipe
1 Part Benzoin
1 Part Poppy Flowers*
1 Part Sandalwood
Ok to use Blue, Red, or Purple as White is hard to come bye.
Oil Recipe
10 drops Benzoin oil
5 drops Sandalwood
Уг ounce base oil*
If you simmer Poppy flowers in your base oil, strain, and then allow to cool before mixing the essential oils, the end result will be far more potent.
Anum—See Anu as Mesopotamia/Sumerian God, not Anu as Irish Goddess.
Anumati—Female—Near East
’Divine Favor’ or ’Conclusion’—Hindu goddess who is cited in distinctly different ways. According to some cites, her name means ’conclusion.’ In that aspect she is associated with the waning and dark moon, as well as endings of all kind. Alternatively, her name is cited as meaning ’Divine Favor,’ and she is thought to be a moon goddess who grants prosperity and children. Perhaps the confusion rests in the Western mind’s attempt to grasp Eastern philosophy. Is not a birth the end of a previous cycle?
Anup—See Anubis
Apedemak—Male—Middle East
Animal association: Lion, Elephant
Sudanese lion-headed god of war.
Apeliotus—Male—Mediterranean
Greek personification of the South East Wind.
Apep—Male—Egypt
(Also known as Aapep, Apepi, Aepepi, Apophis [Greek])
Animal association: Scorpion, Snake, Wolf Plant association: Cactus, Benzoin
Egyptian snake god (monster) who lives in darkness as the opposition to Ra (Sun/Light). Each night, he fights against Ra to prevent the new day. On the few occasions that he wins, the Earth experiences a solar eclipse. The Greeks associated him with Apophis.
Apesh—Male—Africa
Animal association: Tortoise
Obscure Egyptian god form.
Amphitrite—Female—Mediterranean Husband: Poseidon
Greek goddess and ruler, with her husband, of the oceans.
Apisiharts—Male—North America
The name given to the god associated with the planet Venus by the Blackfoot Tribe.
Aphrodite—Female—Mediterranean
(Also known as Aphrodite Pandemos, Cerigo) Husband: Hephaestus
Lover: Anchises, Adonis
Animal associations: Boar, Bee, Chicken, Deer, Dove, Fish, Frog, Hare, Heron, Sheep, Sparrow, Swallow, Swan, Turtle, Tortoise, Vulture
Plant associations: Apple, Cinnamon, Cypress, Daisy, Myrtle, Olive, Orris, Quince
’Foam Born’ —Greek goddess of passion and sex. Unlike many other goddesses of passion, Aphrodite is just that; passion without a connotation of long term relationship Yes, she was called on by Melanion in his pursuit of his wife to be Atalanta, and she is often called on by Wiccans who desire the fire of passion. However, although she gave golden apples to Melanion to win the hand of Atalanta, she was also partly responsible for the Trojan war by demanding another golden apple be hers at the wedding of Peleus and Thetis. From these two stories we see how magick can stir what we commonly think of as love (Aphrodite) and sometimes provide events that are entirely unexpected. You see, although she is commonly called on in love spells, love is a spell unto itself. It needs no help and the help it receives tends to muddle things up. Remember, Aphrodite is also the woman who tired of the husband that adored her, took his gifts, and ran around with every bad boy she could get her hands on. She is the goddess of love who dumps you for the drummer in a bar band.
Incense Recipe
2 parts Orris root
1 part Cinnamon
1 part Cedar
Enough Aphrodite or Cypress essential oil to bind
Oil Recipe
10 drops Cypress essential oil
6 drops Cinnamon essential oil
6 drops tincture of Orris root
1/2 ounce base oil
Apollo—Male—Mediterranean
(Also known as Apollon)
Father: Zeus
Mother: Leto
Wife: Coronis
Lover: Cyrene, Calliope
Animal associations: Bee, Cock, Crane, Crow, Deer, Dolphin, Dragon, Goose, Hawk, Horse, Lion, Mouse, Quail, Raven, snake, Stag, Swan, Vulture, Wolf
Plant associations: Acacia, Alder, Apple, Bay, Cornel, Cypress, Fenugreek, Frankincense, Heliotrope, Hyacinth, Heliotrope, Leek, Lily of the Valley, Lotus, Mistletoe (European), Olive, Palm (date), Sunflower, Thistle, Wormwood
’Destroyer,’ ’Excite,’ or ’Exciting Destroyer’— Initially Greek but adopted by the Romans when the two cultures merged. Brother to Artemis, Apollo is seen as a sun and fertility god. However, he is most often cited as a god of both scientific and cultural education, law, medicine, and fine arts. He was educated, as was his son Aristaeus, by Chiron. Apollo is an ideal deity to work with for assistance during academic pursuit.
Incense Recipe
1 part Acacia flowers
1 part Bay leaf
1 part Gum Arabic
Enough Apollo or Cypress oil to bind
(Add a date or two if using to make a tincture)
Oil Recipe
12 drops Bay essential oil 6 drops Cypress essential oil 3 drops Juniper essential oil 1/2 ounce olive, sunflower, or palm oil
Apsaras, The—Female—Near East (Also known as the Vrikshakas) Animal association: Swan
The female nature spirits of India, similar in nature to water and woodland nymphs. Each is a beautiful woman whose mate is one of the Gandharvas. As the Gandharvas play their drums and other instruments, the Apsaras dance to the natural rhythm of Nature’s gentle cycles. The relationship is similar to the relationship shared between drummer and dancer at Wiccan drum circles. Their dance (both Apsaras and Wiccan) is said to inspire both love and lust. Here we see a rather interesting parallel between modern Wiccan and NeoPagan drum circles and ancient Hindu lore. Far be it from me to either condemn or condone (it is not my place to do either) the revelry at modern drum circles. I have certainly observed the use of not only alcohol, but also other mind and mood altering drugs. It seems that although the story of the Gandharvas and the Apsaras are not generally known in the modern Pagan community, we have certainly found their story in our lives. See Gandharvas for more.
Apsu—Male—Middle East (Also known as Abzu, Absu) Lover: Tiamat
Babylonian (maybe Sumerian) fresh water god from whose clay humanity was formed. He was himself formed when his lover, Tiamat (salt water), separated him from her much as Diana did Lucifer.
Aqas-xena-xenas—Male—North America Wife: The Moon
Chinook hero who married the Moon. He later took his wife’s side with his mother-in-law against his sister-in-law the Sun. This story again illustrates the feminine association of the Sun.
Aquilo—Male—Mediterranean
Roman personification and god of the North Wind associated with the North Quarter (Earth) in Wiccan ritual. The other three are Auster, Favonius, and Vulturnus.
Arachne—Female—Mediterranean
Animal association: Spider
’Spider’—Greek mortal who dared challenge Athena to see who was the best weaver. When they were finished, we see that what was being constructed was more than a craft, it was a story. Athena was outraged that Arachne had portrayed the gods as they had been and without embellishment. Athena punished her by turning her into a spider such that no matter how true she spun her web (history), humanity would run in fear (arachnophobia). Patron of the truly told tales.
Aradia—Female—Mediterranean
Father: Lucifer
Mother: Diana
Plant association: Rue, Vervain
Italian goddess who was sent by her mother Diana to instruct Witches in not only the use of magick, but also to rise against their tyrants and enslavers. Her instructions were recorded in Vangelo, published as Aradia: Gospel of the Witches. Published in the late eighteen hundreds, Vangelo was probably the single largest source of inspiration for the founders of the Wiccan religion.
Aramati—Female—Near East
Hindu goddess of devotion, especially to one’s religion.
Arani—Female—Near East
Hindu fire goddess of female sexual desire. Her worship has involved lesbian and self-pleasuring acts, both without the involvement of men.
Arawn—Female—Central Europe
Animal associations: Boar, Horse (pale), Dog (hound)
Welsh King of the magickal kingdom of Annwn who became the god of the Underworld with a little help from his friend Pywll. Although Arawn and Pywll switched places for a year and a day, during which they took on all outward appearances of each other, Pywll never took advantage of Arawn’s bed and the beautiful wife that waited there night after night unaware of the switch. Together with Pywll, their story speaks volumes about friendships and the value of monogamy.
Arcas—Male—Mediterranean
Father: Zeus
Mother: Callisto
To protect his lover and the son she bore him from Hera, Zeus raised both into the heavens where she became the Great Bear constellation and he the star Arcturus. Their story reminds us of the fact that indiscretions and jealousy can often affect those outside of a marriage.
Ardhanarisvara—Male—Near East
Hindu form of Shiva that demonstrates the historical acknowledgement of transgender and perhaps homosexual aspects of deity. In this form, Shiva is both definitively masculine God and woman at the same time.
Ariadne—Female—Mediterranean
Husband: Dionysus
Plant associations: Ivy (common), Pine
’Very pure’ or ’Very pleasing’ —When Theseus volunteered to kill the Minotaur who demanded human sacrifice, it was Ariadne who gave him the magick sword to do so. As such, Wiccans often call on her during the consecration of both athame and sword. To Theseus, she also gave a bolt of thread that he might use it to find his way back out of the Minotaur’s caverns once he had killed it.
Arianrhod—Female—Central Europe
Father: Beli
Mother: Don
Lover: Gwydion
Plant associations: Alder, Birch, Ivy (common) Holiday: Full Moon
’Silver Wheel’ (often translated as The Moon)—Celtic moon goddess whose story gives us the three rights of initiation seen in many Wiccan traditions. Arianrhod brought into this world two sons. One healthy, the other premature. Upon seeing the child born immature, Gwydion took the child as his own, hiding and tending it until it became healthy. Arianrhod allowed Gwydion to raise the child, but only under three conditions: The child would have no name unless she named him; the child would bear no arms unless she armed him; and the child would never come to know a human wife. Years later, Arianrhod saw a beautiful young man fall a wren with a single stone’s throw. Not knowing he was her son and being greatly impressed, she called out that he was a bright lion with a sure hand. So he was named, Llew Llaw Gyffes. Gwydion then tricked Arianrhod into believing she and her people were under attack, so she armed him. And finally, his wife was created of flowers that his mother’s demands would be circumnavigated.
Ares—Male—Mediterranean
Animal associations: Boar, Horse, Goose, Scorpion, Vulture, Wolf, Woodpecker
Plant associations: Benzoin, Buttercup, Cactus, Dragons Blood, Nettle (greater), Rue, Wormwood
’Man’ (loose interpretation)—Greek god of war who speaks to us of doing battle when necessary. Upon discovering that his daughter had been raped by Halirrhothius, son of Poseidon, Ares immediately killed Halirrhothius for the crime. He was brought before the Olympians by Poseidon and freely admitted his taking of a life. He was acquitted. For that story, he is patron of the rape victims, especially children. His sister, Eris, is his constant companion. As she is the goddess of discord and strife, we see a clear message about the nature of war.
Incense Recipe
2 parts Dragon’s Blood resin
1 part Benzoin
1 part Nettle
1 pinch Wormwood
1 pinch Rue
Enough Ares or Benzoin oil to bind.
Oil Recipe
12 drops Dragon’s Blood perfume oil 9 drops Benzoin essential oil 1/2 ounce olive oil
Aristaeus—Male—Mediterranean
Father: Apollo
Mother: Cyrene
Animal associations: Bee, Cattle
Plant associations: Olive, Vine (grape)
’The best’ or ’Very good’—Greek god, patron of the hunt, bee-keepers, cattle, and negotiating with Nature. Made immortal by Gaia, he was educated in medicine and the science of divination by Chiron.
Oil Recipe
Simmer a mixture of Olive Oil, Raisins, and honey. Strain mixture still warm and then place aside to cool.
Arjuna—Male—Near East
Father: Indra
Hindu god whose conversation with Krishna forms the sacred manuscript known as the Bhagavad Gita. In that discussion, Arjuna contemplated the correctness of a war between two households who were kin. To take up arms was to raise those arms against his kinsmen. To not take up arms was to not raise arms in defense of his kinsmen. He wondered which was the correct course of action. Krishna explained that the course of action is that which is his duty, his dharma or will.
Arsai—Female—Middle East/Mediterranean
Canaanite Earth goddess of Nature. One of the aspects of the Canaanite’s Triple Goddess whose name means ’Maiden of Earth.’ See also Pidrai and Tallai.
Artemis—Female—Mediterranean
(Also known as Amarynthia, Cynthia) Father: Zeus
Mother: Leto
Animal associations: Antelope, Bear, Bee, Boar, Deer (stag), Dog, Cat, Cattle (bull), Elephant, Goat, Hawk, Horse, Quail, Wolf Plant associations: Almond, Aloe, Amaranth, Banyan, Camphor, Cedar, Cypress, Daisy, Damiana, Fir (especially silver), Frankincense, Ginseng, Hazelnut, Ivy (common), Jasmine, Ox-eyed Daisy, Mandrake, Mugwort, Myrtle, Palm (date), Pine, Tarragon, Willow, Wormwood
’Fashion’—Greek goddess of the wild. Within the city, she becomes a goddess of child birth. With associations to Selene, she is seen as a moon goddess, often depicted with a crescent moon. As with many moon goddesses, she is associated with both the tides and menstruation. Artemis speaks to us of our duty as caretakers to the animals of the world. She was huntress, most often depicted with bow and arrows, and chiefly concerned with matters of animal care with special attention to their breeding practices. She reminds us of the Wiccan principle that for Life there must be Death.
Incense Recipe (1)
2 parts Jasmine flowers
· 1 part Mugwort
· 1 part Camphor
Note: I think this Recipe smells horrible
Incense Recipe (2)
· 2 parts Frankincense
1 part Cedar
1 part Jasmine flowers
1 part Cypress
1 part powdered honey
Note: This one smells much better.
Oil Recipe
10 drops Cypress oil
5 drops Cedar oil
5 drops Jasmine absolute or Camphor oil 1/2 ounce base oil made by simmering a mixture of Palm or Almond Oil and Honey, strain, and allow to cool.
Artio—Female—Central Europe (Also known as Artio of Muri) Lover: Essus
Animal association: Bear
Celtic goddess of strength on whom the Celtic bear cults were based.
Arwen—Female—Central Europe Lover: Aragorn
Plant association: Apple
There is a great deal of difficulty discussing Arwen because, due to her inclusion in the Lord of the Rings, great amounts of misinformation have been generated—so much so that even reputable sources seem to include great amounts of fantasy mythology. She is perhaps goddess of inspiration, maybe the elf of procrastination. Arwen is an immortal Elf/God-dess with whom the mortal Aragorn fell hopelessly in love. Her father advised against her returning his love because he did not want her to suffer as she watched him grow old. Upon her father’s advice, she left his side but not his heart. In another version, her love wanted her to take her father’s advice for her own safety.
Aryman—Male—Near East
Father: Kashyapa
Mother: Aditi
Aryman is one of the Adityas. He is associated with the Hindu month Vaisakha (April 21-May 21) See Adityas.
Asclepius—Male—Mediterranean (Also known as Asklepios, Aesculapius) Father: Apollo
Mother: Coronis
Animal association: Raven, Snake
Plant associations: Bay, Mustard (especially black), Juniper, Lily of the Valley, Mustard, Olive, Vine (grape)
’Cut up’—Greek god who was taught medicine and the science of divination by Chiron, who had also instructed his father Apollo. He became such a good doctor that the Underworld was becoming underpopulated. To maintain balance, Zeus struck him dead. His names means ’Cut up’ and refers to his skill as a great surgeon. For this reason his favor is prayed for when facing surgical procedures. ’Here do I evoke Asclepius and bid him lend his hand unto my surgeon.’
Incense Recipe
2 parts Juniper berries
1 part Bay leaf
1 part Gum Arabic
Enough Asclepius or Juniper oil to bind
Oil Recipe
9 drops Bay essential oil
9 drops Juniper essential oil
1/2 ounce Olive oil
Asgaya-Gigagei—Male/Female—North America
(Also known as Asagaya Gigaei, Red Man, Blood Colored Man)
A bisexual or transgender Cherokee god of thunder and lightning.
Ash (1)—Male—Africa
Animal associations: Hawk, Lion, Snake, Vulture
Egyptian god of the desert before that job was taken over by Set. Sometimes seen as having the head of a hawk, other times completely human in appearance, and on rare occasion as human with three heads: lion, snake, and vulture.
Ash (2)—Male—Post Modern
Father: Summer then Light
Mother: Winter then Darkness
Wife: Elm
Like his wife Elm, Ash is said to be thrice born. First of body as are plants, then of soul as are animals, and finally of Spirit. Sometimes associated with Ask.
Ashera—Female—Middle East
(Also known as Asherah)
Husband: Ball, Yahweh
Animal associations: Dog, Cattle
’She who walks in the sea’—Canaanite/ Phoenician who was worshiped as the wife and sometimes sister of Yahweh. She tends to overlap and merge with Anat and Astarte. A clear struggle is seen between her and Yahweh in the insistence of the Israelite clergy to remain devoted to Yahweh. Later condemned in Christian text under the name Ashtoreth.
Ashima Baetyl—Female—Africa/Middle East Animal association: Owl
Husband: Yahweh
One of two Hebrew wives of Yahweh from the fifth century b.c.e. following at Elephantine, Egypt. The other was Anatha Baetyl. See Yahweh.
Ashi-Nadzuchi—Male—Far East
Wife: Tenazuchi-no- Kami
Japanese god of the Earth.
Ashtoreth—See Astarte
Ask—Male—Northern Europe
(Also known as Askr)
Wife: Embla
Scandinavian first man much like the Christian Adam. Created by Odin from the ash tree after the Great Flood, his story is most likely the story of humanity’s migration into Scandinavia after the flood that opened up the Fertile Crescent and northern portions of the Middle East to migration.
Asopus—Male—Mediterranean
(Also known as Asopos)
’Never silent’—Greek river god who dutifully attempted to pursue Zeus after he kidnapped his daughter Aegina. Zeus prevented his pursuit, but could never silence his objection.
Asshur—Male-Middle East/Mediterranean
(Also known as Ashur)
Lover: Ishtar
Animal associations: Cattle (bull), Dragon (snake), Horse (white), Eagle, Goat (female)
Assyrian god who remains the patron of soldiers, although he did evolve into a fertility god. Asshur is one of the many moon gods of the area.
Astarte—Female—Middle East/Mediterranean (Also known as Athtarat, Ashtoreth)
Animal associations: Antelope, Bull, Cattle (bull), Dog, Dolphin, Dove, Fish, Horse, Pigeon, Shark
Plant associations: Acacia, Apple, Cypress, Juniper, Myrtle, Pine, Saffron (Spanish), Sandalwood (yellow)
Holiday: Honored on the 23rd day of April
Phoenician and Canaanite fertility goddess who was sometimes described as a hermaphrodite but was more often shown strictly female. She has been adopted by the modern gay, lesbian, and bisexual community as patron.
Incense Recipe
2 parts Sandalwood (yellow)
1 part Juniper berries
1 pinch Saffron (Spanish) or Cypress
A few apple seeds
Enough Astarte or Pine oil to bind
Oil Recipe
8 drops Pine Oil
6 drops Cypress Oil
6 drops Juniper Oil
1/2 ounce base oil
Astraea—Female—Mediterranean
Animal association: Quail (common)
’Star maiden’—Greek goddess of justice who continues to watch over humanity from the heavens. She is associated with the constellation Virgo.
Astraeus—Male—Mediterranean
Father: Crius
Mother: Eurybia
Wife: Eos
’Starry’—Greek Titan, father of the four Winds; Boreas (North), Eurus (East), Notus (South), and Zephyrus (West).
Asteria—Female—Mediterranean
Husband: Perses
Animal association: Quail
Greek goddess with conflicting stories. One is that she changed into a Quail to escape the pursuit of Zeus (who wanted to rape her). Another version says that to escape, she flung herself into the ocean and became the island by her name.
Asvins, The—Male—Indian
Animal association: Horse
Hindu divine physicians. Sons of Saranyu and Surya.
Ataksak—Male—Arctic North America
Eskimo god of all things joyous.
Atalanta—Female—Mediterranean
Husband: Melanion
’Balanced’—Greek personification and goddess of the female athlete. Patron of women who play hard to get and especially of tomboys. See Melanion, her husband, for their story. She speaks to us of the difference between that which is female and that which is feminine, showing us that one can be a woman despite the possession of attributes commonly thought to be masculine.
Ataokoloinona—See Norianahary
Atar—Male—Middle East
(Also known as Atesh)
Father: Ahura Mazda
Persian god of purity who gave humanity fire and other gifts.
Atargatis—Female—Middle East
Animal associations: Dove, Fish, Pigeon, Snake, Spider, Shark
Mesopotamian/Aramaic mermaid like fertility goddess. She is depicted as half woman and half fish.
Athar—Male—Middle East
Arabian masculine form of Ishtar.
Athena—Female—Mediterranean
(Also known as Athene, Pallas Athena) Father: Zeus
Animal associations: Chicken (cock), Cattle (Ox), Crocodile, Crow, Deer, Dog, Dove, Eagle, Goat, Heron, Horse, Owl, Peacock, Raven, Sheep (ram), Spider, Vulture
Plant associations: Amaranth, Apple, Asafoe-tida, Ash, Belladonna, Cypress, Coconut, Dragon’s Blood, Geranium, Hellebore (black), Henbane, Lily (tiger), Olive, Poke Weed, Woody Nightshade, Willow, Yew
’Protector’ or ’Protectress’—Greek goddess who is most often associated with the art of war. She is also associated with the art of industry and skill. She is a goddess of divine justice and a woman with an open heart. Although her adopted son Erichthonius was born of Gaia and Hephaestus, he did so love his adopted mother Athena that when he rose to King he spread the praise of Athena, thus bringing forth much of her worship. Athena is a warrior goddess. Often called on to protect the home or other sacred space.
Athene—See Athena
Athtarat—See Astarte
Atlas—Male—Mediterranean
Father: Uranus
Mother: Gaia
Lover: Aethra, Pleione
Note: Sometimes cited as the son of Iapetus (father) by either Clymene or Asia.
’Endurer’—Greek god who conspired against Zeus in the war of Titans. His daughter Maia was on of Zeus’ many lovers. Rather than kill Atlas for his traitorous actions, Zeus forced him to endure the burden of the world upon his shoulders.
Atri—Male—Near East
Father: Brahma
Hindu bard who was deified for the great wisdom he expressed in the stories and songs. Prayed to for wisdom.
Attis—Male—Middle East/Mediterranean (Also known as Atys)
Lover: Cybele
Animal associations: Lion, Ram
Plant associations: Adder’s Tongue, Almond, Daffodil, Lily, Pine
A vegetation god. The story of Attis and his lover Cybele is listed under Cybele.
Atum—Male/Female—Africa
(Also known as Tum, Temu)
Animal association: Goose
Plant association: Water Lily
An early Egyptian creator who later became identified as god of the setting sun. He is the first land to emerge on the primeval waters. He created Shu and Tefnut in an act of masturbation.
Auahi-Turoa—Male—Polynesian Islands
Polynesian god who brought fire to humanity. Interestingly enough, the same attribute is sometimes cited under the same name as a god of Australia.
Aunt Piety—Female—Central Asia
Chinese goddess of magick and spellcraft.
Auriel—Male—Middle East/Mediterranean Animal association: Finch (gold)
Semitic god of Earth. Gnostic Arch Angel who is associated with the North Quarter in Wiccan, Gnostic, and Ceremonial rituals. The other quarters are presided upon by Raphael, Michael, and Gabriel.
Aurora—Female—Mediterranean
Plant association: Rose
’The Dawn’—Roman personification and goddess of dawn. Similar to the Greek Eos. Mother of the four Winds who was mentioned in the story of Romeo and Juliet by William Shakespeare.
Avfruvva—Female—North Europe
Animal associations: Shark, Fish
Finnish goddess of the sea who is described much as a mermaid would be.
Audhumla—Female—North Europe Animal association: Cow
In the Scandinavian creation story, she is the cow who nurtured Ymir.
Auf—Male—Africa
(Also known as Auf Ra, Efu Ra)
Animal association: Sheep (ram)
Egyptian avatar/incarnation of Ra, which describes Ra in his dark aspect. This is the name of the Sun God during the nighttime.
Aulanerk—Male—Arctic North America
Animal association: Fish and to an extent all sea creatures.
Eskimo Nature spirit who lives in the waves of the ocean and brings great joy to men with each of his waves.
Aumanil—Male—Arctic North America
Animal association: Whale
American Eskimo Nature spirit who guides the movement of whales.
Austeja—Female—Central Europe/North Europe
Animal association: Bee, Boar
Holiday: Festival celebrated in mid-August.
’Weaver’—Lithuanian goddess. Patron of bee-keepers who accepted honey and beeswax in sacrifice, granting unto bee-keepers who made sacrifice the continued prosperity of their profession.
Auster—Male—Mediterranean
Roman god of the South Wind. The other three are Aquilo, Favonius, and Vulturnus.
Avagdu—Male—Central Europe
Father: Tegid
Mother: Cerridwen
Welsh deity credited as the ugliest boy ever born.
Avalokitesvara—Male—Near East
Indian Buddhist who achieved enlightenment, but rejected ascension to remain on Earth for the betterment of the relationship between animals and humanity.
Aya—Female—Mediterranean/Middle East Husband: Shamash
Babylonian goddess of the dawn.
Ayizan—Female—Caribbean
(Also known as Grande Ai-Zan, Aizan)
Plant Association: Palm
Haitian Voodoo first priestess of Voodoo. Patron of the market place and of initiation rituals.
Azazil—Male—Middle East
Islam adversary to Allah who refused to grovel after Allah created the first man (Adam). Sometimes associated with the Christian Satan.
Azrael—Male—Middle East
Plant associations: Cedar, Juniper, Sandalwood (yellow)
Islamic god/angel/messenger of death and divination.
Incense Recipe
2 parts Sandalwood (yellow)
1 part Cedar
1 part Juniper berries
Enough Azrael or Cedar oil to bind
Oil Recipe
8 drops Sandalwood oil
6 drops Cedar oil
6 drops Juniper oil
1/2 cup base oil
Baal—Male—Middle East
(Also known as Baal-Zebul) Animal associations: Bull, Quail Plant association: Frankincense Sons: Aleion Baal
’Master,’ ’Lord,’ or similar translations— Canaanite/Phoenician fertility and storm god. The name ’Baal’ is also a general term for god. This has led to a great amount of confusion in lore, most notably the Christian association with Beelzebub, who is in league with their Satan. In the Christian Bible, Baal is directly referred to as Beelzebub, a deliberate slur and attack on Baal-Zebul, one of the names of Baal. Interestingly enough, his wife is often listed as Ashera, who is also found sometimes as the wife of Yahweh.
Ba’alat—Female—Middle East/Mediterranean (Also known as Baalat, Baalath)
Animal association: Snake (cobra)
’The Lady’ or ’Divine Lady’—Goddess of the written language and knowledge. She is the patron of authors and librarians. It is likely that the modern Wiccan use of the term ’The Lady’ came from similar uses such as found here. The roots of the story of Adam’s first wife Lilith might be found here with Ba’alat. There is a great deal of debate over the names I have listed here as belonging to Ba’alat. If they are linked as I believe they are, we see the connection through the Canaanites who called Lilith either ’Baalath’ or maybe ’Baalat,’ depending on how one wants to translate wildly different alphabets, vowel use, and spelling. Knowing Ba’alat is a goddess of knowledge and the written language, we see an interesting story unfold in the story of Lilith’s transformation into the serpent who convinced Adam’s second wife, Eve, into eating the forbidden fruit from what is sometimes called the ’Tree of Knowledge.’
Ba’al Gad—Male/Female—Middle East
Animal association: Goat
’Lord of Good Luck’—An amazingly complex amount of lore exists for this relatively simple deity of good luck. His name can be translated easily from the Hebrew. Ba’al (Baal) can be used as both a masculine noun or verb. As the title of a deity, it is a noun which means ’Lord’, ’Master’, or other similar translations. The word Gad is a feminine Hebrew noun meaning ’good luck’. Sounds simple right? Well, the problem is with the repeated translation of the word Gad into the word God simply because it the two words look and sound similar. Combine that with the word Ba’al (again meaning Lord or Master) and sprinkle in a major translation error in virtually every version of the Christian Bible, which associated the word Ba’al with the term ’false’, and we see the emergence of the translation of Ba’al Gad as ’The False God.’ As a result, I have found fundamental Christians (who worship the Lord) to be rather fond of claiming I worship Ba’al (which means Lord), which is entirely too funny.
Ba’al-Hammon—Male—Middle East/Medi-terranean
Wife: Tanit
Animal association: Ram
’Lord of the Incense Altar’ —Phoenician fertility god with lesser associations to the Underworld than to fertility. The Greeks associated him with Cronos, the Romans with Saturn
Babalu Aye—Male—African/Caribbean/South America
In Santeria his name is Babalu Aye/ Chankpanna
In Africa his name is Obaluaye/Omolu/ Sonponno/Soponno
Saint and Catholic association: St. Lazarus
Holiday: Feast of Saint Lazarus on December 17 Plant associations: Angelica, Allspice, Acacia, Almond, Anise, Asafoetida, Basil, Bay, Balm of Gilead, Bergamot (orange), Copal, Clove, Cumin, Cedar, Calamas, Carnation, Citron, Cinnamon, Coriander, Clover (red), Cypress, Camphor, Eucalyptus, Fern, Frankincense, Fennel, Gardenia, Ginger, Garlic, Heliotrope, Honeysuckle, Hyssop, Hyacinth (wild), Juniper, Lime, Lotus, Lavender, Myrrh, Mistletoe (American), Mugwort, Orris, Palmarosa, Red Poppy (seed), Peppermint, Rosemary, Rue, Sandalwood (white), Sage (diviner’s), Thyme, Yarrow
Yoruba god (king who owns the Earth) who migrated into Santeria to become an Orisha of healing. In the mixing of Yoruba and Christian tradition he became associated with Saint Lazarus.
Baba, The—Female—Central Europe
’Old woman’—Hungarian term used to denote a good Witch or a good fairy. Although they stood in opposition to the Baba Yaga (bad Witches), the Baba were eventually lumped in with the Baba Yaga as nasty creatures.
Note: Not to be confused with the Sumerian Bau who is sometimes called Mother Baba or Baba.
Baba Yaga, The—Female—Central Europe (Also known as Baba Jaga, Baba Yaga Kostianaya Noga, Jezi-Baba)
Animal association: Snake
’Bad Old Woman’—Hungarian and East European term to denote a bad Witch. Stood in opposition to the early view of Baba (good Witch).
Babelah—Female—Middle East/Mediterranean
Babylonian and Hebrew goddess of Babylon whose name is also connected by Islam to magick.
Babi—Male—Africa
Animal association: Monkey (baboon)
Egyptian baboon god associated with war and male virility. The modern Pagan community celebrates his lore in the common pendant depicting a phallus with a baboon/monkey riding on it. The charm is said to bring on male sexual virility and strength in conflict. In his role in the judgement of souls, he dines on the souls of those whose judgment was not favorable.
In the Underworld, his phallus is sometimes seen as the mast of a sail boat/ferry that bring new souls across the river to the Land of the Dead.
Bacabs, The—Male—Central America
The Mayan personification of the four principle directions. They are Cauac, Ix, Kan, and Mulac.
Baiame—Male—Australia
Wife: Birrahgnooloo, Birra Nulu
Lover: Yhi
Australian Aborigine moon god and All Father who was the personification of good who stood in opposition with Dardawigal.
Bacchus—Male—Mediterranean
Animal associations: Boar, Dove, Elephant, Panther
Plant associations: Beech, Broom, Fennel, Fig, Ivy (common), Patchouli, Pine, Tamarisk, Thistle, Vine (grape)
Roman god of wine. Greek equivalent Dionysus. His major holiday, the Bacchanalia, was celebrated with wild, intoxicated orgies until the Roman Senate forbade the practice. His cult then went underground, giving rise to the secret societies of Bacchus reportedly alive today.
Incense Recipe
2 parts Patchouli
1 part Thistle
1 part Gum Arabic
Enough Bacchus or a combination of red wine and field honey to bind
Oil Recipe*
1/2 ounce Patchouli essential oil
1/2 ounce Grape seed oil
3 drops Wheat Germ
2 drops Pine essential oil
2 drops sweet wine
2 raisins
* See Wicca Spellcraft for Men for an alternative Recipe.
Badb—Female—Central Europe
(Also known as Badhbh, Badb Catha)
Father: Delbaeth
Mother: Ernmas
Husband: Net
Animal associations: Cow, Raven
’Battle’—Irish goddess of war and one of the Irish Triple Goddesses of Fate. She is a shape-shifter, her favorite form being the Raven. In that form, she is called Badb Catha, which means ’Battle Raven.’ The other two goddesses of fate are Anu and Macha. See also Morrigan.
Bahloo—Male—Australia
Mother: Yhi
Lover: Yhi
Overlaps with Baiame as Australian All Father. Australian Aborigine All Father who, with his creator (mother) Yhi, created all the animals of the Earth, including humanity. This was most likely not an incestuous relationship. See Yhi for details.
Balor—Male—Central Europe
Wife: Dana or Ceithlenn
Daughter: Eithne
Irish leader of the Fomorians, a tribe of Giants. Balor became god of the Irish Underworld.
Balarama—Male—Near East
Lover: Revati
Hindu god and dark skinned twin brother of Krishna. He is sometimes cited with his twin brother as the eighth avatar of Vishnu.
Baldur—Male—Northern Europe
(Also known as Balder)
Father: Odin
Mother: Frigga
Wife: Nanna
Plant associations: Daisy, St. John’s Wort
Scandinavian god who was so loved by both gods and men that the jealous trickster Loki arranged a joke that caused his death. After all attempts to save his life, his wife Nanna died of a broken heart. Sometimes cited as the son of Freya, he is more properly listed as the son of Frigga.
Banbha—Female—Central Europe
Plant association: Yew
Irish warrior goddess and protector of Ireland. With Fodhla and Eire, she is an Irish Triple Goddess.
Banebdjedet—Male—Africa
(Also known as Ba-Neb-Tetet, Banebdjetet, Banaded, Binded, Baneb Djedet)
Lover: Hatmehyt
Animal association: Ram
Egyptian god who helped secure the throne of Horus.
Baron Cimetiere—See Ghede
Baron La Croix—See Ghede
Baron Piquante—See Ghede
Baron Samedi—See Ghede
Bast—Female—Africa
(Also known as Bastet)
Father: Ra
Animal associations: Cat, Lion, Lynx
Plant associations: Catnip, Vervain, Valerian
Egyptian sun goddess who is a prime example of how the genders assigned to the sun and moon changed quite a bit with time. Initially she was a solar deity, but with the introduction of the Greek association to Artemis, she became a lunar deity. She is often depicted with the head of a lion or desert cat and the body of a human. Other times, she is seen as having both head and body of a cat.
Bau—Female—Mediterranean
Also called Baba and Mother Baba
Animal association: Goose
Sumerian Mother goddess of healing. Sometimes associated with Gaia, thus becoming an Earth Mother goddess.
Note: Do not confuse with the East European Baba. They share similar names but are separate figures.
Befana, La—Female—Mediterranean (Also known as La Strega, La Vecchia, Saint Befana)
’Unexpected’ (see note)—Italian Witch who flies down chimneys and brings presents to children on Twelfth Night. The Italian story is that when the three wise men were on their way to welcome the Christian savior to this world, they passed La Befana and invited her along. She declined because she wasn’t much for new fad religions and because she had better things to do, like cleaning her house. But then she had second thoughts. Although she didn’t much agree with the Three Wise Men’s opinion that the child was supremely sacred, he was none the less a child and thus sacred. She tried to catch up with them, but got lost. Feeling so sorry she missed the child’s birthday, she spends the year getting ready for First Night when she flies down the chimney and gives presents to the deserving children whose birthday she missed. If she discovered that the children were undeserving and thus had wasted her valuable time, she instead places a rock or unburned lump of coal. In her story we see a wonderful cite supporting my belief that there is no reason to rob the cultural holiday typically known as Christmas from our Wiccan children. After all, here we see that Santa was once a Witch. Note on her name: The etymology of her name is often cited as ’Epiphany,’ which is a Christian term for the January 6th feast celebrating the divinity of Jesus. However, the word far predates its Christian use and originally meant something more in order of a sudden and unexpected manifestation of divinity without reference to pantheon.
Begochiddy—Male—North America
Native American supreme god of the Navajo.
Behanzin—Male—African
Animal association: Fish
West African patron god of fishermen.
Bel—Male—Middle East/Mediterranean (Also known as Bol)
Wife: Beltis
Animal associations: Cattle (especially Bull), Snake
Ancient Syrian (pre-Islam) sky and Supreme God. Forms a sacred triad with Aglibol and Yarhibol.
Beli—Male—Central Europe
(Also known as Bile, Belenus, Belanos)
Wife: Don
Holiday: Bealtaine
Celtic patron of metalworkers, especially creators of magickal tools. Also patron of sheep, cattle, and the folk who tend them. He is the father of the beloved Dagda and one of the male fertility gods that has managed to work his way into Wicca despite the goddess predomination. Of course he came in a rather hidden way. You see, although very few people realize it, the fertility Sabbat of Bealtaine is named after him. His name has had several changes as it moved from tribe to tribe. Some of those names have been based on a root word meaning ’Shinning one,’ others have meant ’Sacred tree.’ Beli was chiefly a god of Summer. The beginning of his reign was marked at Bealtaine and ended at Samhain. When this principle was followed, Bealtaine was sometimes called Cetsamhain, which literally means ’opposite Samhain.’ While this might sound strange considering the modern Pagan way of splitting the Light and Dark half of the year at the Fall and Spring Equinox, one should remember that the Celts were not overly interested in the Solar Days. As such, that which we now consider fixed Sabbats actually moved around on the Wheel of the Year quite a bit.
Belit-ili—Female—Middle East (Also known as Baalat, Belili) Animal association: Dog Plant association: Willow
Babylonian patron and protector of newborn children who is probably the origin of the story of Lilith. More accurately, her Canaanite name was Baalat or Ballet, which later became Lilith. This is interesting, as with Lilith’s demonification came the stories of how she eats children.
Belitis—See Ninlil
Bellona—Female—Mediterranean
Husband: Mars
Plant association: Belladonna
’War’—Roman goddess of war and combat. She is depicted with spear and shield and accompanies her husband Mars into battle.
Beltis—Female—Mediterranean
Husband: Bel
Babylonian moon and love goddess. She is sometimes seen as wife to Bel and other times as his female equivalent.
Bendis—Female—Mediterranean (Also known as Bendidi) Husband: Sabazius
Thracian/Greek moon goddess. She was known to the Greeks as both Bendis and to some degree as Artemis, depending on the time in history. Her worship often involved wild orgies. Although this may be a wild theory, we see the Thracian Bendis/Bendidi with wild orgies over and over in mythology. We then see her adopted as Artemis by the Greek, and then we see the Roman Diana with her association to the Greek Artemis. Years later, we receive Aradia: Gospel of the Witches from Charles Leland, which in part reads: “And ye shall make the game of Benevento.” Those words are the advice of Diana as presented by her daughter Aradia. Could the celebrations of Bendis/Bendidi be the origin of the seaport named Benevento? And if so, could the term ’game of Benevento’ be a reference to the historically documented orgies associated with the worship of Bendis/Bendidi?
Benten—Female—Far East
(Also known as Benzai-ten, Benzai-tennyo) Animal associations: Dragon, Snake (white)
Japanese love goddess of music and wealth. She is called on for luck, especially by gamblers.
Bertha—See Hulda
Berus—Female—Mediterranean
Husband: Elium
Phoenician All Mother.
Bes—Male—Africa
(Also known as Bisu)
Wife: Ta-Urt
Egyptian dwarf who protects women during childbirth. Prayed to by parents and couples for the betterment not only of children, but also the relationships that support them. He is often depicted skyclad with exaggerated genitals. The key to understanding Bes as a protective god is found in his tremendously ugly outer appearance. Evil cannot see his inner beauty, so it is driven off. The message here seems to be clear: Those with a pure heart are not intimidated or scared by external appearances.
Bestla—Female—North Europe
Lover: Bor
Plant association: Yew
Mother of Odin and goddess of the yew tree.
Bhaga—Male—Near East
Father: Kashyapa
Mother: Aditi
Hindu patron of marriage and god of prosperity. Bhaga is one of the Adityas. The Hindu month Magha (January 21-February 19) is sacred to Bhaga. See Adityas.
Bhairavi—Female—Near East
Husband: Shiva
Hindu avatar/incarnation of Parvati.
Bharti—Female—Near East
Hindu goddess of human speech and language.
Bhatta—Female—Near East
Hindu goddess of magick and spellcraft.
Bhavani—Female—Near East
Plant associations: Cypress, Myrrh, Poppy (especially white)
Holiday: Feast of Lamps on the new moon closest to Samhain.
Hindu goddess whose breasts are the sun and moon. Sometimes seen as a horrific form of Parvati, akin to Kali and Durga.
Incense Recipe
1 part Sandalwood
1 part Myrrh (best to use sweet myrrh if it is available)
1 part Cypress
Enough Bhavani or Cypress oil to bind
Oil Recipe
10 drops Myrrh oil
10 drops Cypress oil
1/2 ounce base oil (best base oil is made by simmering poppy flowers in sesame oil, straining, and then cooling before adding the essential oils)
Bhumi—Female—Near East
Hindu Earth goddess and mother of all living things.
Biliku—Female—Australia (Malaysia)
Husband: Buluga
Animal association: Spider
Spider goddess of the aboriginal Australians and on several of the Malaysian islands.
Birrahgnooloo—Female—Australia Husband: Baiame
Australian Aborigine All Mother.
Birra Nula—Female—Australia
Husband: Baiame
Australian Aborigine goddess who was one of the wives of Baiame, but not chiefly involved in his role as All Father. She is most often cited for giving him grief.
Birren—Female—Central Europe
Husband: Bith
Irish first woman into Ireland. See Bith for her story.
Bishamon—Male—Far East
(Also known as Bishamon-ten, Bishamon-tenno, Tamomtennu)
Japanese god subordinate to Taishaku-ten who guarded the North. The other three were Jikoku, Kimoku, and Zocho. In Wiccan ritual he is sometimes connected with the South Quarter.
Bith—Male—Central Europe Father: Noah
Wife: Birren
Irish God who was sent to the west most point of the known world by his father Noah. There they waited 40 days to escape the Great Flood. With him, he brought his wife Birren, daughter Cesara, her husband Fintaan and a small tribe. After the Great Flood receded, Bith and Birren became the first couple to enter into Ireland. This is no doubt a reference to the Great Flood presented in the Book of Exodus.
Black Annis—Female—North Europe Animal association: Hare
Holiday—April 30th/May 1st
Scandinavian nymph who was associated with the hare and hunting of the hare. Later became associated with the Easter egg hunts of Christianity.
Blodeuwedd—Female—Central Europe (Also known as Blodeuwydd)
Husband: Llew Llaw Gyffes
Lover: Gronw
Animal association: Owl
Plant associations: Birch, Broom, Hawthorn, Meadowsweet, Oak
Welsh goddess who was created specifically to be Llew Llaw Gyffes’ wife. Not only was she unfaithful to Llew, but she plotted his death with her lover Gronw. Llew survived their attack and killed Gronw. Blodeuwedd was turned into an owl to forever mourn her lover’s death during the night hours.
Incense Recipe
Burn the branches of birch, hawthorn, and oak
Boann—Female—Central Europe
Father: Delbaeth
Mother: Ernmas
Lover: Dagda
Animal association: Cow (white)
’She of white cattle’—Irish goddess of the River Boyne. Boann was known as a virgin, not in the sense that she had not yet had intercourse, but rather in the sense that she was an independent women and not subservient to her lover, the Dagda.
Bochica—Male—South America
Wife: Chia
Colombian champion who created/chan-neled the solar calendar and provided it, as well as knowledge of morality, ethics, farming, and the art of negotiating Nature to his people. He is considered the inventor of law, that which allows community to build.
Bolthorn—Male—North Europe
Scandinavian giant and grandfather to Odin.
Bona Dea—Female—Mediterranean
’Good Goddess’—Roman goddess of fertility and interestingly enough, virginity. She is a personification of the Earth who, in antiquity, was celebrated predominantly by women. During those times, men were forbidden to look on so much as her statuary. Today, she is praised by both men and women.
Bor—Male—North Europe
(Also known as Borr)
Father: Bur
Lover: Bestla
Commonly cited as a Scandinavian god, Bor is more of a pre or proto-god who, with his wife Bestla, had three children who are seen as the first gods. Those three are Odin, Vile, and Ve.
Boreas—Male—Mediterranean
Father: Astraeus
Mother: Eos
Greek god of the North Wind associated with the North Quarter (Earth) in Wiccan ritual. Associated with the Roman Aquilo.
Bragi—Male—North Europe
(Also known as Brage)
Father: Odin
Mother: Frigga
Wife: Iduna
Norse patron of poets and poetry who inspired men and gods with his magickal mead.
Brahma—Male—Near East
(Also known as Brahman)
Wife: Sarasvati
Animal associations: Eagle, Swan, Peacock, Raven
Plant associations: American Aspen (poplar), Ash, Common Aspen, Cedar, Cypress, Fig, Hyssop, Ivy (common), Oak, Olive, Saffron (Spanish)
Hindu god who formed the sacred triad with Vishnu and Shiva. Said to have split himself in half, much as the creation story presented in the book of Genesis. His male half is called Purusha and his female half, Satarupa. The two halves then combined to conceive and birth Sarasvati, who later became his wife.
Incense Recipe
2 parts Cedar powder
1 part Hyssop
1 part Cypress
Enough Brahma or Cedar Wood essential oil to bind)
(Add a fig or two if using to make a tincture)
Oil Recipe
12 drops Cypress essential oil
9 drops Cedar Wood essential oil
1/2 ounce Olive oil
Bran the Blessed—Male—Central Europe
Father: Llyr
Mother: Iweridd
Animal associations: Raven, Wren
Plant associations: Alder and all old world grains
Welsh god, brother of Branwen. So did Bran love his sister that when he realized she was abused by her husband Matholwch, the
King of Ireland, he and his kith and kin took arms against the King and his army.
Branwen—Female—Central Europe Father: Llyr
Mother: Iweridd
Husband: Matholwch (King of Ireland) Animal associations: Crow, Raven
’White raven’—Welsh goddess, sister of Bran the Blessed, who tells us that when a marriage has become abusive, it is acceptable to rely on kith and kin for help because it might be their will to do so. See Bran the Blessed.
Bres—Male—Central Europe
Wife: Brigid
Irish god of fertility. He was a horrible leader who at one point raised taxes so high that his people starved. After being dethroned, he raised an army to regain his kingdom. His attempt failed and he was taken prisoner. In exchange for his life, he offered to instruct the people of Ireland in the art of farming and negotiating with Nature. They accepted, and we receive an interesting observation on the quality of leadership or any specific job. Although Bres made a horrible leader, he was a splendid teacher. Ireland quickly became a fertile land under his guidance.
Bridhid—See Brigid
Brigantia—Female—Central Europe Animal association: Cattle
Plant association: Mountain Ash (Rowan)
Celtic fresh water goddess from whom the Braint and Brent rivers were named. She became the patron of cattle and the folk who tend them by a combination of factors, first by the practice of raising cattle close to large supplies of fresh water, and second by Roman occupation. The Romans associated her with Caelestis thus creating ’Caelestis Brigantia.’
Brigid—Female—Central Europe (Also known as Brighid, Brigindo, Brigit) Father: Dagda
Mother: Boann
Husband: Bres
Animal associations: Boar, Cat, Cock, Sheep (ewe),Snake
Plant associations: Blackberry, Mountain Ash (Rowan)
Holiday: Imbolg
Celtic Triple Goddess of inspiration: fire of inspiration (patron of poetry and poets), fire of the hearth/home (patron of fertility and healing), and fire of the forge (patron of metalsmiths and craft folk). Although a separate name may have been used for each aspect at one time, those associations have been lost. Brihaspati—Male—Near East
(Also known as Brahmanaspati)
Wife: Tara
Hindu personification and priest of prayer, chant, and mantra. His words are said to have brought about the creation of the world.
Britannia—Female—Central Europe
British personification of Britain.
Bubatis—Female—Africa (?)/Mediterranean (?) Animal association: Cat
A goddess that seems to appear only in Neo-Pagan lore where she is said to be a Greek cat goddess. I am unable to locate historic cites other than those to the popularity of cat statuary and the goddess Bast/Bastet in the ruins of Tell-Basta (formerly the town/city of Bubatis).
Buddha, The—Male—Near East/Central Asia (Also known as Gautama, Siddhartha)
Father: Immaculate Conception
Mother: Queen Maya
Wife: Yasodhara
Plant associations: Acacia, Amaranth, Bay, Bodhi, Frangipani, Vine (grape)
The word Buddha is more of a title than a name, meaning the ’Enlightened One.’ This particular Enlightened One was an Indian man named Siddhartha. Born about 550 b.c.e., Siddhartha founded modern Buddhism after abandoning his son Rahula (on the day Rahula was born) and wife Maya, taking the alias Gautama, and wandering the country side pretending to be a poor monk although he was born a prince. After his following became large enough to present a clear threat to the Hindu religion, he was declared the ninth avatar (incarnation) of Vishnu to appease his followers. Note: Not to be confused with Budha or “Buddha, Dankinis.”
Incense Recipe
2 part Gum Arabic
· 1 part Acacia flowers
· 1 part Bay leaf
A few raisins
Budha—Male—Near East
Father: Soma
Mother: Tara
Beloved Hindu god whose birth was the result of rape. See Tara for an account. Note: Not to be confused with “Buddha, The” or “Buddha, Dankinis.”
Buddha, Dankinis—Female—Central Asia
Dankinis Buddha is the Tibetan goddess associated with Center, enlightenment, and understanding. See also Vajra, Ratna, Padma, and Karma.
Note: See separate listings for “Buddha, The” and Buddha
Bur—Male—Northern Europe
Son: Bor
Scandinavian grandfather of Odin
Buto—Female—Africa
(Also known as Edjo, Udjo, Wadjet, Wadjit) Animal Association: Mouse, Snake (cobra), Vulture
’Papyrus colored’—Egyptian snake goddess. Her symbol, the cobra, is found on the crown of many Egyptian kings as a talisman of protection. Her name refers to the color of natural papyrus as the color of the female cobra.
Cadmus—Male—Mediterranean
Father: Agenor
Mother: Telephassa
’From the East’—Greek god responsible for inventing/channeling the Greek alphabet. Founder of the city of Thebes.
Cailleach—Female—Central Europe (Also known as Cailleach Beara, Scotia) Animal associations: Adder, Crane, Owl Plant association: Wheat
Scottish All Mother who by some account was also the creator of the world. Her story gives us the custom of the corn doll. Originally made from local grains crops (called corn) to represent the goddess herself, with the introduction of the New World discovery of maize (also called corn) the tradition expanded to include dolls made from cornhusks. This was a doll made by the community farmer who finished the last harvest first. He then passed the doll on to the next farmer to complete harvest as he showed up with his kith and kin to assist in that farmer’s harvest. The practice was repeated until all of the kith and kin of all of the farmers arrived at the last to finish. His was given the doll, his work was the easiest because everyone else helped, and thus in fair exchange for their help he was responsible for taking care of the doll (and the poor/elderly that needed food) over the Winter. If he should be unable or his resources depleted early, he would return the doll and responsibility to the previous farmer who had given him the doll; if that farmer’s stores failed, it would again pass to the farmer before him. This was a form of work equity socialism where he who works the hardest (the ones who finished first and helped all others) is the last to bear the burden of social support because he was the one to offer the most at the harvest. This lore is key to understanding the modern Wiccan approach to the subject of socialism. Yes, we are a community based religion. Yes, we feel that members of our tribe/community should be supported by the whole. However, safeguards must be in place to insure that the lazy do not leech off of those who bear the brunt of the work necessary to keep the tribe/community going because they are already taxed by their own heart and work ethic. They have already given, and asking more of them might well cause them not to offer that which they already do.
Cain—Male—Central Europe
A name sometimes cited as the father of Lugh by Eithne. In those references his father is Dianchecht. However, the name is more commonly cited as the first son of Adam and Eve. In that story, Cain made an offering of grain to the Christian God. God rejected Cain’s offering because he demanded the blood of death in exchange for blessings. This is the most likely reference found in Aradia: Gospel of Witches as the section in which his name is used is discussing a feast of grain.
Calliope—Female—Mediterranean
’Beautiful voice’—Greek muse of epic poetry. See also Muses, The.
Callisto—Female—Mediterranean
Lover: Zeus
Animal association: Bear
Plant association: Willow
’Fairest’—Greek nymph sometimes said to be a moon goddess. The title of moon goddess came about through a connection made to Artemis, whom Callisto very much adored. Knowing that Callisto had taken a vow of chastity and knowing how much she adored Artemis, one day Zeus took on the form of Artemis and found the young Callisto in the woods where she, thinking he was Artemis, let down her guard for just a moment. In that moment Zeus attacked and raped her.
Calypso—Female—Mediterranean (Also known as Kalypso)
Father: Atlas
Mother: Aethra or Pleione
’Hidden’—Greek nymph who so loved Odysseus that even though he wanted to leave her island and return home, she refused and kept him prisoner, by some accounts for seven years.
Camazotz—Male—Central America
(Also known as Camazotx)
Animal association: Bat
Mayan bat god who was defeated in the struggles between the gods.
Carmenta—Female—Mediterranean
(Also known as Carmentis)
Lover: Hermes
Roman goddess of childbirth and divination.
Capys—Male—Mediterranean
The Trojan founder of Capua and father of Anchises.
Cardea—Female—Mediterranean
Plant associations: Arbutus, Hawthorn, and Beans (especially black beans)
Roman goddess and protector of the home and patron of children. She is said to protect children from baneful magick.
Carlin—Female—Central Europe
Celtic spirit who leads baneful spirits in Samhain mischief.
Carman—Female—Central Europe (Also known as Carme)
Holiday : August 1st
Irish Witch/sorceress who bore the Irish Triple God of evil as her three sons: Dian, Dub, and Dother. She and her sons fought against the people of Danu. Carman lost and is now identified as an evil Witch who used all manner of negative magick and curses. However, it is important to remember that while the story might be true, history is told from the viewpoint of the winner.
Carmenta—Female—Mediterranean
(Also known as Carmentis)
Roman goddess of childbirth, writing, and the present. She invented the Roman alphabet and instructed (with her sister Porrima) on its use in divination and (with her sister Postvorta) the recording of the past. With her sisters Porrima and Postvorta, she is seen as a
Triple Goddess. She is one of the Camenae, a collection of beings similar to and later associated with the Roman Muses.
Carna—Female—Mediterranean
Roman goddess of health. She is strongly associated with the liver and heart, but is generally associated with all internal organs. This is extremely interesting as the number one food offered to her in sacrifice is pork and pork fat, showing us another side of sacrifice. If we want our hearts and other internal organs to remain healthy, maybe we should give up pork.
Castor—Male—Mediterranean
Father: Tyndareus
Mother: Leda
Animal associations: Magpie, Beaver
Plant associations: Lucky Hand, Morning Glory, Wormwood
’Beaver’—Greek and Roman god who was the son of Tyndareus, but who is sometimes cited as the son of Zeus. See Leda for the account. With his twin brother Pollux, he was called the Disocuri.
Cassiopeia—Female—Mediterranean (Also known as Casseipeia)
Husband: Cepheus
Greek woman who tried to sacrifice her daughter Andromeda to a sea monster sent by Poseidon. Perseus saved Andromeda from that fate.
Cauac—Male—Central America
Father: Itzamna
Mother: Ixchel
One of the Bacabs, the four Mayan gods of the principle directions. Associated with the color red. In Wiccan ritual he is associated with the South Quarter. See also Ix, Kan, and Mulac.
Ceithlenn —Female—Central Europe Husband: Balor
Daughter: Eithrene
Irish goddess sometimes associated with Dana.
Celaeno—Female—Mediterranean
’The Dark’—Greek Harpy who was charged with creating peace. In that capacity, she and the others are beautiful winged maidens (sometimes virgins). But to keep that peace, she and the others were also the punisher of crime. In that capacity, they are horrid winged beasts. One of the three Harpies. The other two are Aello and Ocypete.
Centon Totochtin—Male/Female—Aztec
(Also known as Centzon Totochtin) Animal association: Rabbit
’Four Hundred Rabbits’—A group of Aztec deities who met frequently for great volumes of alcohol, revelry, and sex.
Ceres—Female—Mediterranean
Father: Saturn
Animal association: Ant, Boar
Plant association: Adder’s Tongue, Bay, Daffodil, Leek, Lily, Narcissus, Pomegranate, Poppy (all), Wheat, Willow
Italian/Roman personification of the love that a mother has for her children. Also goddess of grain and crops. As she evolved, she has been associated with Tellus Mater and Demeter. The month Sextilis is sacred to Ceres.
Cernunnos—Male—Central Europe
(Also known as Hu’Gadarn, Herne, Kernunnos)
Animal associations: Antelope, Bear, Crane, Deer (stag), Wolf, Bull, Otter, Sheep (ram), Snake, Goat
Plant associations: Bay, Heliotrope, Oak, Orange, Patchouli, Sandalwood, Sunflower Holiday: Bealtaine
’Horned One’—Celtic Horned God who tends to be associated in the Neo-Pagan community predominantly with the hunt. Historically speaking, he is more of a prosperity and fertility god, oftentimes being depicted (as was Pan) with an erect penis and sometimes with a bag of coins. When not shown with an erect penis, he is shown with a large snake that has the head of a ram. His most famous depiction in this capacity is on the Gundestrup cauldron, which was found in Denmark. He is god of Nature and especially of the woods. Said to marry the Earth Goddess at Bealtaine, but also associated with the Underworld and the Dark half of the year.
Incense Recipe
· 2 parts Gum Arabic
1 part Bay leaf
1 part Orange peel
1 part Sandalwood (yellow)
Enough Cernunnos Oil to bind*
Oil Recipe
10 drops Bay oil*
8 drops Orange oil
2 drops Sandalwood oil 1/2 ounce Sunflower oil
* Note: Some folk use either musk or patchouli oil.
Cerridwen—Female—Central Europe (Also known as Ceridwen, Grandmother Moon, Kerridwen)
Lover: Tegid
Animal associations: Boar (sow), Chicken (hen), Dog (greyhound), Otter
Plant associations: Acorns, Apple, Vervain, Willow
Holidays: Samhain, all dark moons
Welsh Witch and moon goddess most often associated with the dark moon. Mother of the ugliest boy (Avagdu/Afagddu ) and most beautiful girl (Creirwy) in the history of the world. She is a goddess of shape-shifting and of being able to adapt to one’s environment. She is prayed to for easing the suffering of childbirth, like the mother who comforts her daughter as she gives birth. She is the owner of a cauldron named ’Amen,’ within which she stirs a magick potion named ’greal.’ That potion is said to grant all inspiration and knowledge, which she created for her son Avagdu/ Afagddu that he might compensate for his repulsive looks with great wisdom. See Gwion for more information.
Cesara—Female—Central Europe
Father: Bith
Mother: Birren
Husband: Fintaan
Irish woman who led the journey west described under her father’s name. Became the first woman into Ireland after the Great Flood. See Bith.
Chac—Male—Central America
(Also known as Chac Mol)
Animal associations: Jaguar, Panther, Snake (serpent)
Mayan god of thunder and rain who is associated with crop fertility. May have been an early form of Cauac.
Chandra—Male—Near East
Lover: Tara
Animal associations: Antelope, Hare
Plant associations: Aloe, Almond, Camphor, Celandine (lesser), Hazelnut, Mugwort, Sandalwood (yellow)
Hindu seventh avatar of Vishnu. He was originally also a moon god, but that association became absorbed by Soma. He is patron of couples who seek to have children and is prayed to for granting that aspiration.
Incense Recipe
2 parts Sandalwood
1 part Mugwort
1 part Gum Arabic
Enough Chandra or Sandalwood oil to bind.
Oil Recipe
10 drops Sandalwood oil
10 drops Camphor oil
1/2 ounce base oil (try a 50/50 mix of Hazelnut and Almond oil)
Ch’ang-O—Female—Central Asia
Husband: Excellent Archer
Animal association: Hare
Chinese moon goddess who fled her husband in fear of his anger. When she did, she stole from him the drink of immortality. She speaks to women of the strength necessary to leave an abusive relationship. Note: Do not confuse with the African/Caribbean Chango.
Chantico—Female Goddess—Central America Animal associations: Dog, Snake (red serpent) Plant association: Paprika
’She who lives in the home’—Aztec god of home, hearth, and volcanoes. Her story comments on the principle of the kin familiar. She was originally found in human form but violated a law that stated paprika would not be eaten on fast days. In punishment, she was turned into a dog, the most popular kith familiar in Arctic North, and North, South, and Central America. Interestingly enough, this is not so much the case in Europe and not at all in Asia, where her lore is geographically separated.
Charon—Male—Mediterranean
Father: Erebus
Mother: Nyx
’Fierce Brightness’ or ’Fierce Brilliance’— Greek god who conducted souls across the River Acheron into the Underworld. Later cites would say the river was Styx, but those cites seem far less accurate.
Chaos—Male—Mediterranean
Mother: Achlys
Daughter: Nyx
Animal association: Alligator
’Great Void’ or ’Gaping Void’—Greek origin/ Creator god similar to the Nameless One in the creation story given in the Book of Genesis. Nyx is sometimes listed as his wife and other times as his sister, with Erebus brother to both. I believe this came into play with the old question: Where did the first god come from if s/he did not have a mother and father? Note that the story of Diana and her brother Lucifer is told here as well. Chaos was born from his mother Achlys, whose name loosely means ’dark mist.’
Chasca—Female—South America
Inca goddess of flowers who protects young women.
Chia—Female—South America
Husband: Bochica
Colombian moon goddess who was patron of women and men who dressed like them. In other references, men dressed like women to escape her wrath after they had offended her. With her association to the moon, and thus the tide, she is sometimes cited as the one responsible for the Great Flood. Patron of crossdressing men.
Ch’i-lin—Female—Central Asia
Chinese creature guardian of the West. She is similar to the unicorn in having a single horn, but is described as having the tail of an ox, the body of a deer, and the scales of a fish. She presides over that which is good and pure. The other guardians are Ch’i-lin, Gui Xian, Feng-huang, and Long. They are collectively known as the Ssu Ling.
Chiminigagua—Male—South America
Animal association—Blackbird
Chibcha Creator god who set order to the universe by causing light to come from eternal darkness. He spread that light across the world with the assistance of Blackbird.
Chiron—Male—Mediterranean
Father: Cronos
Mother: Philyra
Animal association: Horse
’Hand’—Greek educator who taught Apollo and the sons of Apollo: Aristaeus, Asclepius and Orpheus. In some references he was one of the Centaurs (half man and half horse).
Chung, Mo Li—Male—Central Asia
Mo Li Chung is the Chinese Buddhist guardian of the East. His statue is often included at the east point of Buddhist temples. In the modern practice of Feng Shui, his statue is placed in the East-most part of a home to protect from negative influences coming from that direction. In Wiccan ritual, he is one of the names for the Four Quarters, the other three being Hung, Shou, and Hai.
Chu Pa-chieh—Male—Central Asia
Animal association: Boar
Chinese student and guardian of the Tang Monk Tripitaka who journeyed to the western heavens to secure the knowledge of the Buddha.
Cinteotl—Male—Central America
Mother: Tlazolteotl
Plant association: Corn
Aztec and Toltec corn (maize) god. His suffering brought forth the corn that fed his people. Not that it made much difference to the brutal Spanish invaders, he was associated with the Christian Jesus such that his worship could continue in hiding. The attempt was similar to the African slaves’ development of Santeria, only this one mostly failed.
Circe—Female—Mediterranean
Father: Helios
Mother: Perse
Animal association: Falcon, Hawk, Boar (sow), Wolf
Plant association: Belladonna
’Falcon’ —Beautiful Greek Witch/sorcer-ess who with her magick could and did turn men into boars, lions, and wolves.
Clio—Female—Mediterranean
(Also known as Kleio)
’Announcer’ or ’Proclaimer’—Greek Muse of history. See also Muses, The. She is sometimes cited as the Muse who brought the Phoenician alphabet into Greece.
Cliona—Female—Central Europe
Father: Gebann
Irish goddess who possessed legendary beauty.
Clymene—Female—Mediterranean
Husband: Helios
’Famous might’—Greek nymph or maybe goddess who is cited as having several different potential genealogies.
Coatlicue—Female—Central America
Animal association: Snake
’Skirt of Serpents’—Aztec Earth and Fire goddess who wears a skirt of snakes. She was betrayed by her children and decapitated. In vengeance, she bore Huitzilopochtli in full armor, who later killed many of her children who had plotted against her. The theme behind her story is a similar one connecting birth and death in the never-ending cycle.
Cocidius—Male—Central Europe
Animal association: Deer (stag)
Celtic god of the hunt.
Concordia—Female—Mediterranean
(Also known as Charistia)
Roman goddess of order, peace, and harmony in opposition to Discordia. Her temple served as a meeting place. In her depictions, she demonstrates the principle of sacrifice. In one hand she holds a sacrificial bowl, and in the other hand, a cornucopia (horn of plenty). Sacrifice made to one yields benefits from the other is the order of the universe.
Consus—Male—Mediterranean
Animal association: Donkey
Roman god of harvest, especially grain harvests. His major holiday is the Consualia, celebrated twice a year, first after the planting season and then again after the harvest of those crops.
Corn Goddess—Female—North America/ Central America/South America
(Also known as Corn Mother)
Animal association: Grouse
Plant association: Corn
The principal grain goddess of North, Central, and South America found in many different cultures as simply Corn Mother, Corn Goddess, or by her many different names including Chicomecoatl (Aztec), Iyatiku (Keresan Pueblos), Xilonen (Aztec), Zaramama (Peruvian), and many others. Sometimes listed in other cultures as a reference to a grain goddess/ mother because the word corn is also a general reference to grain.
Corn Mother—See Corn Goddess
Coronis—Female—Mediterranean
Lover: Apollo
’Raven’—Wife to Apollo who, while pregnant with Asclepius, informed her husband that she was unfaithful. He killed her for her infidelity and set her on a funeral pyre. Before her body was completely consumed, he removed his son Asclepius and restored him to life. By some accounts, he also restored her to life, but not before the fire turned her white feathers black, thus explaining why the raven has black feathers. Although Asclepius is cited as son of Apollo, it is not clear if this story is an act of adoption or if it was Apollo’s natural son. In another story, she was the hostage of Neptune who was changed into either a raven or a crow by Athena in order to escape.
Cotys—Female—Mediterranean
(Also known as Cottyto)
Greek and Sicilian fertility goddess who was celebrated with orgies. Her name is one potential source of the word coitus, which denotes sexual union. Her followers’ orgies became so debauched that even she became disgusted with them.
Cronos—Male—Mediterranean
(Also known as Cronus, Kronos) Father: Uranus
Mother: Gaia
Wife: Ashtart, Dione
Lover: Philya, Rhea
Animal associations: Crow, Donkey, Raven Plant association: Beech
’Crow’—Greek god who is sometimes seen as the father of the Greek pantheon. One glance at associations and it is easy to see why one would make that observation. Not only did he father three of the major male figures in the Greek pantheon by his lover Rhea, he married both Ashtart and Dione (each one of his sisters).
Cihuatcoatl—Female—Central America
Animal association: Snake (serpent)
Aztec goddess of childbirth who was known as ’Serpent Woman’. Mother of Mixcoatl. Patron of pregnant women, especially at birth.
Coyote—Male—North America
Animal association: Coyote
Native American god form shared by many tribes. Like Loki, Coyote is the trickster.
Crom Cruaich—Male—Central Europe Holiday: Lughnasadh
Irish god associated with Lughnasadh and the last Sunday in July, known as Domhnach Chrom Dudh (loosely, ’Chrom’s Sunday’).
Cuchulain—Male—Central Europe
(Also known as Cuchulainn, Cu Chulainn, Setanta)
Father: Sualtam, Lugh (adopted)
Wife: Emer
Irish culture hero, whose most often cited father, Lugh, speaks to us of kith turning into kin. His natural father is the mortal by the name of Sualtam, but Lugh adopted him.
Culhwch—Male—Central Europe
Father: Kilydd
Mother: Goleuddydd
Wife: Olwyn
Welsh culture hero who can be seen to have connections to the Wiccan reenactment of the Oak and Holy King story. Culhwch desired the hand of Olwyn in marriage. Her father, Ysbadadden, knew that should Culhwch take his daughter in marriage, he would himself die.
Cupid —Male—Mediterranean
Father: Mercury
Mother: Venus
Plant associations: Bay, Cypress, Juniper, Olive, Rose (especially red), Sugar, Violet (especially white)
Note: Some state Cupid was the son of Venus and Mars.
’Desire’—Roman god who is most often cited as god of love, but his stories better show him as god of lustful desire. Greek equivalent is Eros.
Incense Recipe
2 parts red rose petals and buds
1 part Cypress
1 part Juniper berries
1 part Gum Arabic
Best if you use enough Otto of Rose to bind. Ok to use Cupid oil or Juniper essential oil.
Oil Recipe
6 drops Cypress essential oil
6 drops Rose essential oil
3 drops Juniper essential oil
1/2 ounce Olive oil
Cybele—Female—Middle East/Mediterranean (Also known as Magna Mater, Kybele) Lover: Attis
Animal associations: Bee, Lion, Dog, and of all creatures of the wild.
Plant associations: Cypress, Heather, Oak, Poppy (especially white), Myrrh, Pine
’She of the hair’—Greek goddess of the Earth and of all creatures in the wild. She took rather serious action when she discovered her lover’s intent to marry another woman. Upon discovering Attis’ plans, she caused him to go insane. As a result, he castrated himself and presented her with his genitals. Her following started in the Middle East and then spread north into the Mediterranean, bringing along with it the practice of castrating oneself in her honor.
Incense Recipe
2 part Myrrh
1 part Cypress
1 part Heather
1 part Gum Arabic
Oil Recipe
8 drops Cypress
6 drops Pine
6 drops Myrrh
1/2 ounce base oil
Cyrene—Female—Mediterranean
(Also known as Kyrene)
Father: Hypseus
Mother: Creusa
Lover: Apollo
’Sovereign queen’—When she was seen wrestling with a lion by Apollo, it was love at first sight. He immediately carried her off and built a city in her honor and by her name.
Da-Bog—Male—Central Europe
Father: Svarog
Slavonic fire and sun god. Associated with a healthy home through his connection to fire and the hearth.
Dada—Male—African/Caribbean/South America
Saint association: St. Raymond Nonnatus Holiday: Feast of Saint Raymond Nonnatus on August 31
Patron of newborns and protector of children.
Dagan—Male—Mediterranean
See also Dagon and Ben Dagon.
’Grain’—Babylonian god of agriculture and to some extent negotiating with nature.
Dagda, The—Male—Central Europe
(Also known as Daghda, Dagde, Dagodevas, Cian)
Wife: The Morrigan
Lover: Boann
Plant association: Heather, Hops, Oak
’The Good God’—Irish Celtic All Father and god of the Earth. Kind ruler of Life and Death, master of magick, warrior, and highly skilled at many crafts.
Dagon—Male—Mediterranean
See also Dagan and Ben Dagon as their names are often interchanged.
Father: Uranus
Mother: Gaia
Animal association: Fish and to an extent all creatures of the sea.
’Grain’ or ’Corn’—Mesopotamian god of crop fertility who invented the plough and instructed humanity on how to negotiate with nature. He is often depicted as a merman.
Daksha—Male—Near East
Father: Brahma
Hindu god whose 20 daughters were the days of each month (phases of the moon) who each married Soma, the 28th day and the moon itself.
Damballah—Male—Caribbean
(Also known as Damballah, Dambala, Bon Dieu)
Animal association: Snake (serpent)
Haitian Voodoo fertility god and All Father figure. He is the father or master of each of the loa and the most important deity in the Haitian Voodoo tradition.
Danae—Female—Mediterranean
An oracle told Acrisius that the son of Danae would one day kill him. To escape this fate, Acrisius locked Danae away. Because Zeus held great lust for her, he came to her as a shower of gold (one of his preferred tricks) and together they became the parents of Perseus who later killed Acrisius just as fate had said he would. The message here seems to be two-fold, the first being that lust tends to triumph over precaution. The second is that the ancient Greeks clearly believed in the concept of Fate founded in the nature of a person, as opposed to the will of the gods.
Dakini—Female—Near East
Hindu goddess associated with the Muladhara chakra (base of the spine). Sometimes described as an aspect of Shakti. See also Rakini, Lakini, Kakini, Sakini, and Hakini. Do not confuse with the Tibetan Dankinis.
Dankinis, The—Female—Central Asia (Also known as The Kadomas)
Five Tibetan goddesses that represent the Tibetan model of five principle directions (North, South, East, West, and Center). They were often shown skyclad as a symbol that they bring the naked truth. See Vajra, Ratna, Padma, Karma, and Buddha, Dankinis. Note: Do not confuse with the Hindu goddess Daikin.
Daramulum—Male—Australia
’One leg’—Australian Aborigine god to whom one prays and makes tribute to bring power in medicine and spellcraft. He is associated with initiation rites, especially of the ascension into manhood.
Dardawigal—Male—Australia
Australian Aborigine god who was the personification of Evil and antagonist to Baiame.
Dragon—Male—Middle East
Animal associations: Fish, Snake (serpent)
Most often cited as a mystical creature, some Neo-Pagan literature states that Dragon is also the name of a god in the early Middle Eastern religion of Philistia. I have not found this to be the case in mainstream scholarly works.
Daikoku—Male—Far East
(Also known as Daikoko-tenn)
Animal association: Rat (white)
Japanese god of prosperity, especially the prosperity of agricultural harvest.
Damkina—Females—Mediterranean
Husband: Ea
Animal association: Lion
Babylonian/Sumerian goddess and chief lover of Ea/Enki. Despite his seduction of many other goddesses, she remained by his side and worked with him as partner in most matters.
Damgalnuna—See Damkina
Dana—Female—Central Europe (Also known as Danu, Dan, Dann) Father: Delbaeth
Mother: Ernmas
Husband: Balor
Irish Mother and Earth goddess. Principle leader of the Tuatha De Danann, an Irish race of gods.
Danh—Male—Africa
(Also known as Dan Petro [Haitian Voodoo])
Animal association: Snake
African god of negotiating with Nature who migrated to the Caribbean to become Dan Petro, the Haitian Voodoo loa of farming.
Dardanus—Male—Mediterranean
(Also known as Dardanos)
Father: Zeus
Mother: Electra
Wife: Batea
Greek God and founder of Dardania (later called Troy).
Dea Artio—Female—Central Europe
Animal association—Bear
Celtic goddess of the Bear cults.
Dea Tacita—Female—Mediterranean
(Also known as Dea Tacti)
Roman goddess of silence, of keeping secrets, and of death. Associated strongly with Larentia.
Dechtire—Female—Central Europe
(Also known as Dectera)
Father: Cathbad
Lover: Lugh
Irish mother of Setanta by Lugh. Her son went on to kill the hound of Culann the Smith, after which he was known as Cuchulainn.
Delbaeth—Male—Central Europe
Father: Oghma Grainaineach
Lover: Ernmas
Irish god and father, by Ernmas, of the Morrigan.
Demeter—Female—Mediterranean
Father: Cronus
Mother: Rhea
Lover: Zeus, Iasion
Daughter: Persephone by Zeus
Animal associations: Cock, Crane, Dove, Lion, Pig, Fish, Ant
Plant associations: Barley, Bay, Beans (all), Cypress, Frankincense, Myrrh, Pennyroyal, Pomegranate, Rose, Sunflower, Wheat, Poppy (white), and all cultivated plants that bear food.
’Barley Mother’—Greek goddess associated with Spring Equinox and Bealtaine fertility rites. She is often cited as a ’corn goddess,’ but with the modern use of the term corn to mean a specific plant, she is better termed a grain goddess, especially barley. She taught humanity how to plow and negotiate with Nature.
Oil Recipe
8 drops Frankincense essential oil
6 drops Otto of Rose
5 drops Cypress essential oil
1/2 ounce base oil
Deucalion—Male—Mediterranean
Father: Prometheus
Wife: Pyrrha
’New-wine Sailor’—Greek story of the Great Flood centered on Prometheus warning his son Deucalion, who built an ark capable of surviving the flood. Deucalion and his wife, Pyrrha, then repopulated the Earth.
Devaki—Female—Near East
Husband: Vaseduva
Hindu mother of Krishna. Sometimes cited as an avatar/incarnation of Aditi.
Devi—Female—Near East
Animal association: Swan
’Goddess’—Hindu All Mother. Goddess of both motherly and romantic love. She is the mother of the Hindu culture.
Dharma—Male—Near East
Wife: Sradda, Samnati, Medha
Hindu personification of duty (dharma) to community, self, family, and to the gods themselves. Husband to either one, two, or three of the listed wives, depending on specific cite. Similar to Pietas (Roman Goddess) and representative of the principle presented in the Wiccan Rede as will.
Dhatri—Male—Near East
Father: Kashyapa
Mother: Aditi
Dhatri is one of the Adityas. The Hindu month Kartika (October 23-November 21) is sacred to Dhatri. See Adityas.
Dianchecht—Male—Central Europe
Son: Cain, Miach
Daughter: Airmid
Irish god of healing and of medicine. He is often cited as the father of modern medicine. Patron of doctors, healers, pharmacists, and herbalists.
Dian—Male—Central Europe
Mother: Carman
’Violence’—One of the aspects of the Irish Triple God of Evil. The other two aspects are Dub and Dother. It is interesting to note the name similarity to the Roman Diana, who is said in Aradia: Gospel of Witches to have sent her daughter Aradia to show the Witches the ways of magick such that they can violently overthrow their oppressors. Dian’s mother is said to be Carman, a Witch herself who taught her children the ways of Witchcraft that they might combat the people of the goddess Danu.
Diana—Female—Mediterranean
(Also known as Tana [Etruscan]) Lover: Lucifer, Endymion
Animal associations: Alligator, Bear, Cat, Dear (especially stag), Dog, Elephant, Antelope, Bee, Owl
Plant associations: Acacia, Almond, Apple, Banyan, Beech, Birch, Damiana, Dittany of Crete, Fir, Ginseng, Hazelnut, Jasmine, Mandrake, Mugwort, Mulberry, Oak, Rue, Willow, Wormwood
Roman moon goddess of Nature, childbirth, fertility, and hunting. Her sacred month is October. She has been associated with the fertility of the Earth, with mountains, and the deep forest. She was patron of the working and lower economic class, a goddess of slaves and wage slaves of past and present. Her following likely persisted well into the rule of Christian Europe when it was said she was the Goddess of Pagans. Her worship may have continued uninterrupted to the present day. See also Lucifer, Aradia, and Dian. Dian might be a male Irish counterpart, although this is wild speculation on my part.
Incense Recipe
2 part Gum Arabic
1 part Acacia Flowers
1 part Jasmine Flowers
1 pinch Wormwood
1 pinch Mugwort
A few apple seeds
Enough Diana oil or Jasmine absolute to bind
Oil Recipe
10 drops Jasmine absolute
10 drops Birch oil
1/2 ounce base oil (try a 50/50 mixture of Almond and Hazelnut oil)
Dianus—Male—Mediterranean
Plant association: Fig, Oak
Roman oak god who evolved into Janus.
Diiwica—Female—Central Europe
(Also known as Devana, Dziewona)
Animal associations: Horse, Dog
Slavic goddess of the hunt. Associated with Diana. There could be a root word connection between her name and the word Wicca/Wica, especially considering the late 1800s use of the word Wicca by Leland in reference to the worship of Diana and other remnants of the Mediterranean and European Pagans.
Dike—Female—Mediterranean
’Justice’ or ’Natural law’—Greek goddess of justice for humanity, but a justice connected with natural law rather than the law of man. When Zeus saw that her job of keeping humanity in tune with the laws of Nature was impossible, he recalled her to Olympus where she now resides. She is most often cited as a being virgin. However, sometimes cit6ations indicate she never had sex with men, implying that her affections are lesbian in nature. She is one of the Horae with her sisters Irene and Eunomia.
Dionysus—Male—Mediterranean (Also known as Dionysos)
Father: Zeus
Mother: Semele
Wife: Ariadne
Lover: Adonis, Althea, Hermaphrodite Animal associations: Bull, Cheetah, Lion, Panther, Tiger, Fox, Donkey, Elephant, Goat, Ram, Bee, Deer (fawn)
Plant associations: Agaric Mushroom (also all toadstools and mushrooms to a lesser degree), Apple, Fennel, Fig, Ivy (common), Juniper, Patchouli, Pine, Pomegranate, Vine (grape)
Greek god of fertility in each order of life. He is most often cited as the god of wine. While that is certainly a valid association, he is called on more for the intoxication of love and of merriment than simple drunkenness. Dionysus is an educated god for an educated devotee. Having been the lover of Adonis and Hermaphrodite, he is an excellent example of bisexual deity forms and has thus been adopted by many in the gay, lesbian, and bisexual community as a patron. Although he is associated strongly with Bacchus, there is a clear difference. To understand that difference, consider James Morrison in his early years (Dionysus) and then in his later years just prior to his leaving the United States (Bacchus).
Incense Recipe
8 parts pine needles (or 2 part pitch and 6 part sandalwood)
5 part Sandalwood (white/yellow)
4 part Juniper berries
1 part raisins
Enough Dionysus or Patchouli essential oil to bind (better to use Patchouli)
Oil Recipe
9 drops Patchouli essential oil
6 drops Juniper essential oil
3 drops Fennel essential oil
3 drops Pine essential oil
1/2 ounce grape seed oil
3 drops red wine
2 raisins
Discordia—Female—Mediterranean
Roman goddess of disorder, discord, and chaos in opposition to Concordia. She was said to precede Mars, sometimes the chariot of Mars, thus noting that discord and chaos often lead to war. See also Eris (Greek equivalent).
Oil Recipe
Cover your skyclad body with baby oil and try to play Twister while balancing your checkbook.
Disocuri—Male—Mediterranean
(Also known as Dios kouroi)
’Sons of Zeus’—Greek title of the twin brothers Pollux and Castor born of Leda and Zeus who are associated with the astrological sign Gemini.
Diti—Female—Near East
Father: Daksha
Husband: Kashyapa
Hindu mother goddess of both Earth and the endless sky.
Dolma—Female—Central Asia
(Also known as White Tara)
Animal association: Lion
Plant association: Lotus
National goddess of Tibet before Tibet was illegally taken by communist China. An erotic goddess of passion and compassion. She tells us that wisdom can go hand in hand with sexuality, and that the faithful mother can also be a sensual wife.
Don—Female—Central Europe
Husband: Beli
Sons: Amathaon Caswallawn, Govannon, and Gwydion by Beli
Daughter: Arianrhod by Beli
Animal association: Gull
Welsh All Mother goddess similar to the Irish Danu.
Dother—Male—Central Europe
Mother: Carman
’Evil’—One of the aspects of the Irish Triple God of Evil. The other two aspects are Dub and Dian.
Duamutef—Male—Africa
(Also known as Tuamutef)
Father: Horus
Mother: Isis
Animal association: Jackal
Egyptian god associated with the element Fire and with the East. Associated with the Goddess Neith. Wiccans who have adopted an Egyptian pantheon often associate their Quarters to align with Egyptian associations made with the Four Sons of Horus. The other three are Hapi, Imset, and Kebechsenef.
Dub—Male—Central Europe
Mother: Carman
’Darkness’—One of the aspects of the Irish Triple God of Evil. The other two aspects are Dother and Dian.
Dumuzi—Male—Middle East/Mediterranean
Animal association: Bull
Holiday: Fall Equinox
Sumerian mortal who married Inanna to bring fertility to his land. So offended was his wife at his lack of sensitivity and concern for her needs, that she ordered him to leave the world of the living for six months out of the year, thus bringing the barren months of Summer. He was allowed to return to the land of the living at Fall Equinox (the beginning of the Sumerian new year) but then had to leave again at Spring Equinox. Upon his return to his wife’s bed, all was well, as absence makes the heart grow fonder. Here we see clearly the principle of separation for the sake of union, but we see something else that is of key note in understanding Wicca as a world religion. The story of Dumuzi leaving every Fall Equinox is incredibly similar to the story of Persephone. The main difference is the gender of the two subjects and the time in which their story was told. During the time of Persephone’s story, the area surrounding her story was overly cold and barren in the winter (while she was gone). During the time of Dumuzi’s story, the area surrounding his story was overly hot and thus barren (while he was gone).
Durga—Female—Near East
Animal associations: Lion, Tiger, Bison Husband: Shiva
Hindu avatar/incarnation of Parvati.
Dwyvach—Female—Central Europe Husband: Dwyvan
See Dwyvan for her story.
Dwyvan—Male—Central Europe
Wife: Dwyvach
Welsh man who survived the Great Flood with his wife Dwyvach. Together, they built an ark called Nefyed Nav Nevion, filled it with animals, and survived the flood. Their story, combined with the Irish, seems the most likely origin for the Christian story of Noah and his ark.
Dyaus—Male—Near East
(Also known as Dyaush, Dyaush-Pitir)
Wife: Prithvi
’Sky father’—Hindu lord of the sky and of the clouds that float there. As such, a fertility god granting rain that fertilizes crops.
Dylan—Male—Central Europe Animal association: Fish (silver) Father: Gwydion
Mother: Arianrhod
Wife: Lady of the Lake
’Sea’—Welsh god who was born by Arianrhod before she relinquished her virginity.
Ea—God—Mediterranean
(Also known as Ea-Oannes, Ea-Onne, Enki [Sumerian])
Father: Ansar
Mother: Kishar
Wife: Damkina
Son: Adapa, Marduk
Daughter: Gasmu, Inanna, Nanshe, and Nina Note: His mother is sometimes cited as Bau.
Animal associations: Dolphin, Goat, Fish, Turtle, Tortoise, Frog, Antelope, Ram Plant association: Cedar
Babylonian/Sumerian god of magick, especially Water magick, and wisdom. He taught man about culture, community, and civilization building. Patron of community builders.
Incense Recipe
1 part Cedar
· 1 part Gum Arabic
Ea-Oanne—See Ea
Ea-Oannes—See Ea
Ebisu—Male—Far East
Father: Daikoku
Japanese god of labor, especially labor related to fishing and prosperity brought about by the sea.
Ehecatl—Male—South America
’Wind’—Aztec god of the Wind who fell so deeply in love with a mortal woman named Mayahuel that all of humanity learned love from his example.
Eingana—Female—Australia
Animal association: Snake
Aboriginal Australian All Mother and Creator goddess who resides in the dream time. Prior to her birthing of all creatures, she had no vagina but could not stop dreaming the wondrous creatures into existence inside her womb. Realizing she was in great pain as her womb swelled, Barraiya (a fellow god) sliced her open with a spear. From that womb sprang all the animals of the world. That they would not suffer the same pain, each female creature was born with the wound already in place. The link between dream time and creation speaks volumes to the Wiccan belief in, for lack of a better word, the Etheric World.
Eire—Female—Central Europe
(Also known as Eriu, Eyre, Eiriu)
With Banbha and Fodhla, she is an Irish Triple Goddess. Her name is the origin of the word Ireland in the former form Eire Land.
Eite—Male—Central Europe
Lover: Persipnei
Etruscan god of the Underworld.
Ek Chuah—Male—South America
(Also known as Ekchuah)
Animal association: Scorpion
’Black war lord’—Mayan god of war who was fierce in battle. Also a kind patron of merchants and travelers, but not both at the same time. His story, like so many others, tells us that prosperity and war are often opposite points on the same scale. Greater prosperity leads to less war. More war leads to less prosperity.
El—Male—Mediterranean
(Also known as El Elyon [’God Most Holy’]) Father: Uranus
Wife: Elat
Lover: Damkina
Animal association: Bull
’God’—Supreme Canaanite God who is the most likely source from which the story of Yahweh/Jehovah is most likely derived.
Elat—Female—Mediterranean
(Also known as Asherat of the Sea [Asheratian])
Husband: El
’Goddess’—Canaanite goddess and wife to El. She is associated with the ocean, especially the shores where she enjoys long walks, sometimes hand in hand with her husband, El, when not tending to her children.
Electra—Female—Mediterranean
Father: Agamemnon
Mother: Clytemnestra
Greek goddess of revenge. After her father was killed by his adulteress wife and her lover Aegisthos, Electra plotted revenge with her brother Orestes. There is some dispute to whether or not Electra helped execute the plot. At a minimum, she planned the murders and Orestes carried them out. Later, she stood loyally by her brother’s side, defending him at every step. See Orestes for the rest of the story.
Eleggua—Male—African/Caribbean/South America
In Santeria, his name is Eleggua
In Voodoo, his name is Legba/Liba
In Africa, his name is Elegba
Also variously known as Esu/Eshu (West Africa) and Exu (Brazil)
Saint associations: St. Anthony (most often), others include St. Michael, St. Peter, St. Martin de Porres, St. Benito
Holidays: Feast of Saint Anthony of Paudua on June 13, Feast of the Holy Infant of Atocha on January 1
Plant associations: Allspice, Anise, Angelica, Asafoetida, Balm of Gilead, Basil, Calamus, Calendula, Camphor, Cayenne, Clove, Coffee, Copal, Cumin, Dill, Dragon’s Blood, Eucalyptus, Garlic, Ginger, Grains of Paradise, Geranium, Heather, Heliotrope, Hibiscus, Honeysuckle, Horehound, Hyacinth (wild), Hyssop, Juniper, Lavender, Lemon Balm, Lilac, Lime, Lotus, Mallow (blue), Mandrake, Meadowsweet, Mimosa, Mint, Mistletoe (American), Mugwort, Myrrh, Orange (sweet and bitter), Orris, Orange Bergamot, Peppermint, Pine, Rosemary, Rue, Sage, Sandalwood (white/yellow), Snapdragon, Thistle (greater), Vetivert, Violet, Valerian, Vervain, Wormwood
In Africa, he is god of the crossroads. In migration into Santeria, he becomes Orisha and trickster similar to the North Europe Loki or the North America Coyote. He can be a powerful ally in both magick and the mundane. But in all matters he must be given great respect and accepted as he is rather than as one might want to see him. He treats his devotees with what can best be summed up as tough love.
Incense Recipe
· 2 part Dragon’s Blood
1 part Copal
1 part Orris Root
1 part Juniper Berries
1 pinch ground coffee bean
Enough Eleggua or Lavender oil to bind
Oil Recipe
8 drops Clove oil
8 drops Lavender oil
4 drops Eucalyptus or Sandalwood oil
1/2 ounce base oil
Elihino—Female—North America
Cherokee Earth Mother Goddess.
Elium—Male—Mediterranean
Wife: Berus
Phoenician All Father.
Elli—Female—North Europe
(Also known as Elle)
Teutonic personification of old age. She was the only one to ever beat Thor at a wrestling match, the observation being that one cannot beat old age.
Embla—Female—Northern Europe Husband: Ask
Scandinavian goddess much like the Christian Lilith prior to her replacement by Eve. Created by Odin from either the elm tree or, by a few references, grapevine after the Great Flood. Her story is most likely the story of humanity’s migration into Scandinavia after the flood that opened up the Fertile Crescent and northern portions of the Middle East to migration.
Emer—Female—Central Europe Husband: Cuchulain
Irish goddess who demonstrates an enormous amount of self-worth. Before she would allow Cuchulain into her bed, she insisted that he accomplish several great tasks—not that she needed them done, she just needed him to show her that he felt she was worth the great effort. With full knowledge that the tasks were given for this purpose, he accommodated her requests because he knew there was no other way to prove his devotion.
Endymion—Male—Mediterranean (Also known as Endamone)
Lover: Selene
Greek mortal who was so loved by Selene that she begged Zeus to make him immortal. He did, but at the cost of Endymion’s eternal sleep. Perhaps a god form that symbolizes humanity, visited nightly by the Moon (Selene) as we sleep. See Selene for more of the story. In the book Aradia: Gospel of Witches, this story is identified with Endymion and Tana (an Etruscan name of Diana) rather than Selene.
Enlil—Male—Mediterranean/Middle East
Father: Anu
Mother: Anat
Wife: Ninlil
Note: Mother sometimes listed as ’Ki’ because she is wife to ’An’ and in some views, An is a form of Anu (father to Enlil).
Animal association: Dragon (snake)
’Lord wind’—Babylonian/Sumerian storm god who holds the tablets of destiny and fate and who causes hardship when it is necessary. In Babylonian and Sumerian lore he is responsible, in part, for the Great Flood. Also seen as a god of the mountains.
Enki—Male—Mediterranean
Mother: Bau
Wife: Ninhursag
Lover: Ninsar, Ninkurra, Uttu
Animal associations: Antelope, Lion, Fox, Cattle (bull), Frog
Sometimes cited as the father of Ishtar. Enki is a Sumerian water god who had sexual relations with his daughter Ninsar, with his granddaughter Ninkurra, and with his greatgranddaughter Uttu. As a result, his wife Ninhursag cursed him. Believing it was in Enki’s nature to have conducted himself as he did, the gods convinced Ninhursag to change her curse to better address his nature. This speaks to us of our duty to negotiate nature. While the nature of a thing like water can be to kill (flood), it can be harnessed to provide clean energy. While the nature of a creature might be to love, we negotiate with that nature. That negotiation is the process by which we understand will and that negotiator is the will itself. Again we see: Love is the law, but love ONLY under will. Some cite Enki as another name for Ea. Those cites are probably the result of Bau (Mother of Enki) being listed as mother of Ea. Due to this link, Inanna is sometimes cited as daughter of Enki.
Enmesarra—Male—Mesopotamia Wife: Ninmesarra
Animal association: Pigeon
’Lord of Law’—Sumerian god of the Underworld. In noting the meaning of his name, it is important that we do not interpret the word law to mean the law of humanity. The translation might better be to ’Lord of Mes,’ mes being the power of the law (love) as expressed in ’Love is the law.’ Not a written law. Enmesarra is Lord of that force by which communities and entire civilizations are built. That force is the unification principle of the Fifth Element.
Ennoia—Female—Mediterranean/Middle East
Gnostic Aeon of thought and clear intent.
Enodia—Female—Mediterranean
Animal association: Dog
Greek goddess of the crossroads and transition. Called on at the moment of decision to help bring that decision but not necessarily the right or most correct. Often there is not one choice more right or correct.
Enurta—Male—Mediterranean
Father: Enlil
Wife: Gula
Babylonian god of war and triumph over physical confrontations.
Eos—Female—Mediterranean
(Also known as Aurora)
Father: Hyperion
Mother: Theia
Husband: Astraeus (first)
Animal association: Horse (Pegasus)
’Dawn’—Greek mother of the four Winds and personification of Dawn. See also her sons Boreas, Zephyrus, Eurus, and Notus. She was much loved by Ares. That love brought the jealousy of Aphrodite, who also loved Ares greatly. As revenge, Aphrodite caused Eos to fall in love with several others, including Orion. Orion was later killed and Eos felt much grief. The story changed as did her men, but at the end of each relationship Eos was miserable, and Aphrodite was usually the cause. The story here seems to be a warning about the pains that love can bring one who does not have clear intent or who desires another woman’s man.
Eostra—Female—Central Europe/North Europe
(Also known as Ostara, Eostre, Eastre) Animal association: Hare
Plant association: Birch
Holiday: Easter
Germanic personification of sunrise who is associated with the Spring, and thus a fertility goddess in her own right. She is often cited as having a kin familiar of a hare whom she changes into a bird as a magic trick to amuse and entertain children, which she loves. As a result of the transformation, the hare laid won-drously colored eggs that she gave to the children. She is one of the many wonderful examples of why Wiccans have no reason to reject cultural holidays. After all, in her story we see that Easter (typically rejected by many Wiccans) is the celebration of the Goddess Eostra (or Eastre). It is interesting to note that the Christian celebration of Easter marks the celebration of the rising of the son of their god, and the Pagan celebration of Easter celebrates the rising of the Sun, Eostra (or Eastre).
Epona—Female—Central Europe/Mediterranean Animal association: Horse, Goose, Dog
Celtic horse goddess who was involved in the judging of souls after human death. So popular did she become in the Roman army that a temple was erected to her in the Roman capital. From the spread of her worship from the Celts to the Romans, we see that conflict tends to generate a two-way flow of cultural traditions.
Epunamun—Male—South America
Araucanian god of war who was so vicious in battle that even his own people had occasion to fear him.
Erato—Female—Mediterranean
’Lovely’—Greek muse of love poetry. See also Muses, The.
Erh-lang—Male—China
(Also known as Er-lang)
Animal association: Dog
Master of the dogs of Heaven who destroys evil by sending his dogs to devour it in any form.
Erigone—Female—Mediterranean
Father: Icarius
Animal association: Dog
Plant association: Pine
Greek daughter of Icarius. When she found that her father had been put to death unjustly by her own people due to a misunderstanding, she committed suicide by hanging herself from a pine tree. Her kin familiar is a dog named Marea. When Dionysus found what had happened, he caused all the maidens of the land to become insane and to take their own lives as did Erigone.
Erinyes, The—Female—Mediterranean (Also known as The Eumenides) Animal association: Snake (serpent)
Three Greek goddesses of both justice and vengeance, reminding us that the lines between the two are often blurred. See also Alecto, Megaera, and Tisiphone.
Eris—Female—Mediterranean
’Strife’—Greek goddess similar to the Roman Discordia. She demonstrates how small actions of discord can turn into huge amounts of strife. Her constant companion is her brother Ares. As he is god of war, we see a clear message telling us that discord and strife are often accompanied by war. See Peleus for an excellent example of this principle.
Eros—Male—Mediterranean
Father: Erebus
Mother: Nyx
Lover: Psyche
Animal associations: Goose, Hare
Plant associations: Bay, Olive, Rose (especially red), Saffron (Spanish), Yarrow
’Desire’—Greek god who is most often seen as a god of love. He is also the god who calls attention to the value of a person’s lineage and the importance of relationships over individuality. Historically and today, he is called on to bless both heterosexual as well as homosexual relationships. He was called on by gay soldiers to give them blessings before battle. When we consider the meaning of his name, we see an interesting commentary on the nature of soul (his lover Psyche). Soul is not without desire. This is the principle on which I base the principle of animals having soul, as they certainly have desire. See Psyche for more information.
Incense Recipe
4 part Rose petals (match color to intent)
2 part Bay leaf
1 part Gum Arabic
Enough Eros or Otto of Rose to bind (Otto of Rose is best)
Oil Recipe
9 drops Bay essential oil
6 drops Yarrow essential oil
6 drops Otto of Rose
1/2 ounce Olive oil
Erebus—Male—Mediterranean
Father: Chaos
Lover: Nyx
Greek god whose name is also a reference to a region in which souls must pass before entering the afterlife/Underworld. Nyx is sometimes cited as his sister, other times his mother. See Chaos for an explanation.
Ereshkigal—Female—Middle East/Mediter-ranean
Lover: Nergal
Sumero-Babylonian goddess of the Underworld. She is considered dark and violent, lashing at the souls of those who have not lived a good life. With her lover Nergal, we see a clear personification of many of the attributes Christianity has given to Satan. See Nergal for the rest of the story.
Erichthonius—Male—Mediterranean
(Also known as Erechtheus)
Father: Hephaestus
Mother: Athena by adoption, Gaia by birth
Greek god who was adopted and raised by Athena, who became King of Athens, where he sung the praises of his mother that the worship of Athena spread to all of Athens and beyond.
Erzulie—Female—Africa/Caribbean/South America
(Also known as La Siren)
Plant associations: Basil, Cardamom, Frankincense
May be a unique deity or may be another name for Oshun. There is evidence to support either. See Oshun.
Incense Recipe
2 parts Frankincense
1 part Cardamom
1 part Basil
Oil Recipe
10 drops Basil oil
10 drops Cardamom oil
1/2 ounce base oil
Esaugetuh Emissee—Male—North America
’Master of breath’—Muskogean (Creek) All Father and Creator god who repopulated the world after the Great Flood.
Eschetewuarha—Female—South America
Husband: Great Spirit
Chamacoco Mother Goddess who insures that humanity receives rain from the cloud bird Osasero. Her husband is the Great Spirit.
Essus—Male—Central Europe
(Also known as Esus)
Lover: Artio
Plant associations: Oak
Celtic god of agriculture and negotiations with Nature.
Eunomia—Female—Mediterranean
’Good order’—Greek goddess of order and the laws of man (legislature) who lives with humanity, assisting us to create legislature that will cause the laws of man to be in harmony with the laws of Nature. She is one of the Horae with her sisters Dike and Irene.
Euphrosyne—Female—Mediterranean
Father: Zeus
Mother: Euronyme
’Rejoices the heart’ or ’Happiness’—One of the Three Graces found in Greek lore. Her parents are sometimes cited as Dionysus and Aphrodite. See also Thalia and Aglaia.
Europa—Female—Mediterranean
Husband: Asterius
Lover: Zeus
Animal associations: Cow, Dog
One of the many loves of Zeus. To Europa, he gave a dog named Laelaps who became her kin familiar. After her relationship with Zeus, she married Asterius.
Eurus—Male—Mediterranean
Father: Astraeus
Mother: Eos
Greek god of the East Wind associated with the East Quarter (Air) in Wiccan ritual.
Euterpe—Female—Mediterranean
’Delight,’ ’Source of Rejoice,’ or ’Rejoicing Well’—Greek muse of wind instruments. See also Muses, The.
Evander—Male—Mediterranean
(Also known as Euandros)
Father: Hermes
Mother: Carmenta
Roman deity who brought the Greek culture to Rome, thus mingling the pantheons and traditions in such a way that the citizens of Rome could see that although at odds with each other for some time, the two could coexist and even compliment each other.
Eve—Female—Middle East
(Also known as Haiwa [Arabic])
Second wife of Adam. See Adam and Lilith.
Evenor—Male—Mediterranean
Wife: Leucippe
Greek Earth-born/primeval man and husband to the nymph Leucippe. His wife accompanied Persephone when she was kidnapped by Hades.
Excellent Archer—Male—Chinese
Wife: Ch’ang-o
Chinese god whose anger was feared by all, including his wife. To escape his anger, she fled to the moon after stealing the drink of mortality from him. His story warns folk of the damage unchained anger can do to a marriage.
Fama—Female—Mediterranean
’Fame’—Roman personification of fame and goddess of rumor. Everything that she said was first said softly to the few to whom she spoke and then repeated over and over until it was almost deafening. Sometimes described as a terrifying creature with a great number of ears, eyes, and tongues. If she has a motto, it is ’No publicity is bad publicity.’
Fand—Female—Central Europe Husband: Manannan Mac Lir
Irish fairy queen who married Manannan Mac Lir but whose marriage ended in divorce. Her story shows support for the Wiccan principle of handfasting being dissolvable.
Farbauti—Male—North Europe
Wife: Laufey
’Cruel striker’—Scandinavian god of fire whose story is partially responsible for the creation of Merlin. Seen sometimes as the Scandinavian Merlin, his more important story can be found in the relationship between he and his wife. She provided the wood for his fire, not for the fire created by him, but for his existence itself, his soul. This speaks of action being masculine, but the force behind that action being feminine. It is very similar to the Hindu principle that states the masculine is the fountainhead, but the feminine is the fountain or water.
Fates, The—Female—Mediterranean (Also known as The Moirae) Father: Zeus
Mother: Themis
Animal associations: Dove, Spider
Greek three daughters of Zeus and Themis who presided on the destiny of mortals. Their blessings are called at handfasting in so much to say that we respect the will of the gods even in the matters of human union. See Clotho, Lachesis, and Atropos.
Clotho—Spins the thread of life. Lachesis—Presents the element of chance.
Atropos—She who cuts the thread.
Fati—Male—Polynesian
Father: Roua
Mother: Taonoui
Polynesian personification of the moon and moon god.
Fauna—Female—Mediterranean
(Also known as Marica)
Husband: Faunus
Plant association: Pine
Roman Earth and fertility goddess. She is sometimes said to be another name for Bona Dea. See also Faunus.
Faunus—Male—Mediterranean
(Also known as Lupercus)
Father: Picus
Wife: Fauna
Animal associations: Goat, Bee
Plant associations: Bay, Olive, Patchouli, Pine
Roman god of fertility and Nature. Provides visions as we sleep, especially when sleeping outdoors. With his wife, he shares the holiday Lupercalia. Today, this holiday is called Valentine’s Day. He is sometimes cited as father of Fauna, as well.
Incense Recipe
4 parts pine needles (or 1 part pitch and 3 part sandalwood)
2 part Gum Arabic
1 part Bay leaf
Enough Faunus or Pine essential oil to bind.
Oil Recipe
9 drops Pine essential oil
9 drops Bay essential oil
3 drops Patchouli essential oil
1/2 ounce Olive oil
Favonius—Male—Mediterranean
Roman god of the West Wind similar to the Greek Zephyrus. The other three are Aquilo, Auster, and Vulturnus.
Februus—Male—Mediterranean
Etruscan/Roman Underworld god for whom the month of February is named.
Felicitas—Female—Mediterranean
Roman personification and goddess of success.
Fene-Ma-So—Male—Africa
Animal association: Vulture
West African sky god who took the form of a vulture, the king of the birds, to observe happenings on Earth.
Feng-huang—Male—Central Asia (Also known as Feng Haang)
Chinese creature guardian of the South. Similar to the phoenix, but with the head of a pheasant and the body of a peacock. He presides over the primordial attributes of divinity. The other three guardians are Ch’i-lin, Gui Xian, and Long. They are collectively known as the Ssu Ling.
Fenrir, The—Male—North Europe
(Also known as Fenris, Fenrisulfr, and The Fenris Wolf)
Father: Loki
Mother: Angurboda
Animal association: Wolf
Scandinavian giant in the form of a wolf whom prophecy states will one day devour the world. Fearing this prophecy, the Norse gods locked the Fenrir in a cage. Even as a pup, the Fenrir was so terrifying that only their god of war was brave enough to feed it. Once it had grown into adulthood, the gods decided it had to be destroyed or rendered harmless. But they were scared to try and harm the creature, so they decided to trick it, twice. Their first trick failed. Their second is destined to fail, at which point Ragnarok, the Doom of the Gods, will be announced. One of the three children of Angurboda and Loki in which we see the number three as the number of not only good fate, but of ill fate. The other two children are Jormungand and Hel.
Fergus—Male—Central Europe
Wife: Flidais
Lover: Queen Medb (most notably)
’Virility’—The name Fergus is used widely in Irish lore; however, one Fergus stands out in respect to polyamorous (sexually open) relationships. Such was Fergus’ sexual desire, that he was known widely for his adulterous relations with mortal women. Such was his wife’s accepting of his practices while she was away, that she bragged that it took seven mortal women to satisfy the thirst that she alone could quench. As a very strong sexual innuendo, he is often times called ’The Great Horse.’
Feronia (1)—Female—Mediterranean
Animal association: Wolf
Roman goddess of crop fertility who was seen as patron and freer of servitude. Note: Not to be confused with Feronia (Etruscan fire goddess).
Feronia (2)—Female—Mediterranean
Etruscan Fire goddess who brought both human and plant fertility. Possibly a reference to the fire of lust that causes human fertility, or to the burning of fields to bring fertility to the soil.
Fides—Male/Female—Central Europe
’Faith’—Roman goddess (sometimes cited as god) of good faith. In the Wiccan religion, Fides is the patron of the contract set forth at any handfasting, but particularly at the third handfasting. S/he is also the patron of fidelity in a romantic relationship; however, in that aspect he should not be considered the patron of monogamous relationships alone. Instead, he is the patron of all relationships in which a promise is kept, but particularly of monogamous relationships. Patron of all oral contracts.
Fintaan—Male—Central Europe Wife: Cesara
Irish survivor of the Great Flood. See Bith for the story.
Flidais—Female—Central Europe
Husband: Fergus
Animal association: Deer
Irish goddess who could be the patron of polyamorous couples. See Fergus for the story of her marriage.
Flora—Female—Mediterranean
Plant association: Hawthorn
Roman goddess of Spring and Spring flowers. With time she became the patron of prostitutes and young women who choose to live a sexually promiscuous lifestyle.
Fodhla—Female—Central Europe
With Eire and Banbha, she is an Irish Triple Goddess.
Forseti—Male—Northern Europe (Also known as Vorsitzer)
Father: Baldur
Mother: Nanna
Scandinavian god of justice and the peace that justice brings to a community.
Fortuna—Female—Mediterranean
(Also known as Primigenia, Virilis, Respiciens, Muliebris, and Annonaria)
Roman personification and goddess of fortune and fertility. Historically, she was worshiped primarily by mothers and soon-to-be mothers. At some of her rituals, women who were still with their first husbands were the only ones permitted to attend.
Freya—Female—Northern Europe
(Also known as Froya)
Father: Njord
Mother: Skadi
Husband: Od
Lover: Odin
Animal associations: Cat, Falcon, Horse, Boar (sow), Bear, Hare
Plant associations: Apple, Birch, Cowslip, Daisy (especially Ox-eyed), Maidenhair, Mistletoe (European), Myrrh, Primrose, Strawberry
Scandinavian goddess of love and fertility, the most beautiful goddess in the Norse pantheon. She is patron of birth and of the desires that lead to conception. She is said for a time to have been married to Od, which has led many folk to claim she was married to Odin, but that story seems to be based on superficial associations. (Odin’s wife better sited as Frigg/ Frigga).
Freyr—Male—Northern Europe (Also known as Frey, Yngvi) Father: Njord
Mother: Skadi
Wife: Gerda
Animal associations: Boar, Horse
Norse god of rain who is both fertility god and warrior. He is called upon to bless human fertility at Wiccan handfasting. His chariot was drawn by Gullibursti and Slidrurgtanni, two boars.
Frigga—Female—Northern Europe (Also known as Frig, Frigg)
Husband: Odin
Son: Baldur
Plant associations: Birch, Mistletoe (European)
Frigga is sometimes associated with Freya as if they were one and the same. This was probably a result of the gradual shift towards the promotion of monogamy. For the purpose of historical accuracy, it is best to identify the two separately. Frigga is patron of love, marriage, pregnancy, and childbirth, said to know the destiny of both god and human, but never telling of it. Definitely a non-monogamous goddess, she is said to have had many lovers other than her husband Odin, including Vili and Ve (both his brothers).
Fukurokuju—Male—Far East
Animal associations: Crow, Crane, Deer, Tortoise, Turtle
Japanese Shinto god of health and wisdom.
Furies, The—Female—Mediterranean (Also known as Erinyes, Eumenides)
Animal association: Dove, Snake
Furrina—Female—Mediterranean
Husband: Neptune
Roman Earth Mother.
Fu-Hsing—Male—Central Asia
(Also known as Fu-Xing)
Wife: Nu-Kua
Animal associations: Bat, Snake
’Lucky Star’—Chinese god of happiness who is often depicted surrounded by children.
Gabriel—Male—Middle East/Mediterranean (Also known as Gabri-el [Hebrew])
’Man of God’—Semitic god of Water. He is one of the only two angels mentioned by name in the modern Christian Bible. The other is Michael. He was the angel who appeared to the Virgin Mary to foretell her conception of Christ. Gnostic archangel who is associated with the West Quarter in Wiccan, Gnostic, and Ceremonial rituals. The other Quarters are presided upon by Raphael, Michael, and Auriel.
Gad—Male/Female—Middle East
Wife: Gadda
’Good luck’ or ’Good fortune’ (masculine use of the word)—Semitic/Chaldean god of good fate and fortune. Very often, his name is mistranslated to ’God.’ Sometimes appears male, other times as female with Gadda as his female counterpart.
Gadda—Female—Middle East
Husband: Gad
’Good luck’ or ’Good fortune’ (feminine use of the word)—Semitic/Chaldean goddess of fortune. See Gad.
Gadel—Male—Central Europe
Irish god who split the Gaelic tribes into five people and five categories: warriors, poets (bards), historians, doctors, and the working class. Also created the five Gaelic dialects.
Gaia—Female—Mediterranean
(Also known as GAO, GE)
Father: Elium
Mother: Berus
Lover: Hephaestus, Uranus, Poseidon Plant association: Apple
’Land’ or ’Earth’—Greek Earth Mother whose immaculate conception gave birth to Pontus (the Oceans) and Uranus (the Sky). With them, she forms a holy trinity of Land, Sea, and Sky (a principle generally thought to be Celtic/Druid in origin). Although she is often depicted as the Earth herself, she was historically associated more with the one-third of the Earth that is dry land.
Gama—Male—Far East
Animal associations: Deer (stag), Toad
Japanese god of long life.
Gandharvas, The—Male—Near East Animal association: Horse
This is one of my absolute favorite speculations. In Hindu mythology, the Gandharvas are Air spirits who haunt the forest and mountains. They were typically associated with dry creatures, birds, and animals. They are the mates of the Apsaras (water nymphs) who were associated with fish and other damp creatures. These spirits were said to jealously protect Soma. Now, here is the interesting part. Soma is a word that not only describes the Hindu deity that the Gandharvas protect. The word is also associated with the Fly Agaric Mushroom. Moving right along, the Gandharvas are also Hindu musicians and performers who entertained the line of Indra. Like most stories of bard-type characters, the Gandharvas were rather fond of women’s affections (especially young ones) but were not all that fond of formalities. Thus, they are thought of as patrons of romantic relationships prior to or without formality of a wedding or handfasting. Now then, what is that old saying about musicians having the best drugs? While I am not promoting the use of the Fly Agaric Mushroom to improve one’s musical inclination (let’s face it, they are also called the ’Death
Cap’ mushroom), it is interesting to note that even today the use of drugs to achieve altered states of consciousness is still associated with the creative abilities of musicians and other artisans.
Ganesa—Male—Near East
(Also known as Ganessa, Ganesha) Mother: Parvati
Wife: Buddhi, Siddhi
Animal associations: Elephant, Rat
Plant associations: Damiana, Fenugreek, Jasmine, Peanut, Sesame
Hindu god of wisdom and fortune. He is said to be the remover of obstacles and is associated with higher learning, especially of cultural matters. If you are a fan of classic literature, chances are Ganesa is your patron even if you have not noticed. He is also patron to large men in their search for gracefulness and ’Lord of Hosts.’ Ganesa is married to Buddhi and Siddhi simultaneously without much conflict or jealousy. Ganesa can thus be seen as patron to marriages in the order of polyfidelity. He is sometimes described as having soft skin and breasts like a woman. As there is also a degree of lore stating that his worship has involved homoerotic rituals and anal sex, he is sometimes seen as a bisexual deity. However, his chief description would be the perfect host to the many guests invited to his worship and his home.
Incense Recipe
2 part Sandalwood (yellow/white)
1 part Jasmine flower
1 part Damiana
Enough Ganesa or Jasmine absolute to bind
Oil Recipe
12 drops Jasmine absolute 9 drops Damiana tincture 1/4 ounce sesame oil
Ganymede—Male—Mediterranean (Also known as Granymedes) Father: Tros
Mother: Callirhoe
Animal associations: Eagle, Peacock
Plant associations: Coconut, Olive
Greek god who served as cup bearer to Zeus. He is thus associated with the chalice of Wiccan rituals and is the patron of fathers and other men in the act of giving away the bride at Wiccan handfasting. There is clear reference to Zeus also being his lover. This union with Zeus, his title ’Cup Bearer,’ and the associations made with the cup (chalice) in Wiccan ritual may well be useful to the gay Wiccan community in their development of Wiccan rituals.
Gauri—Female—Near East
Husband: Varuna
Animal association: Cow
Plant association: Rice
’Fair’ (reference to her light-colored skin)—Hindu mother goddess as balance to Kali.
Gavida—Male—Central Europe
Irish god who is patron to metal workers. May be another name for Goibniu and Govannon.
Gayomart—Male—Middle East/Mediterranean Animal association: Bull
’Dying life’—Initially the Persian first man, similar to Adam, created by Ahura Mazda. He lived for thousands of years. From his body sprang the twin children who would become the Persian Adam and Eve. Although Mashia and Mashiane are cited here as brother and sister, neither was born of mother and father. Instead, they were born as twins of the spirit of Gayomart sometime after his death. Hence, their marriage was not incestuous.
Geb—Male—Africa
(Also known as Seb, Keb)
Father: Shu
Mother: Tefnut
Wife: Nut
Animal associations: Duck, Goose
Egyptian god of the Earth whose skin was at times green as the growing plants or black as the fertile farm land surrounding the Nile. In addition to being an Earth god, he prevented evil souls from rising to Heaven. This is perhaps similar to the modern Krishna idea that earthly pleasures prevent one from ascending beyond this level of existence. In Wiccan ritual he is associated with the North/ Earth Quarter. See also Ra, Tefnut, Shu, and Nut.
Gefion—Female--Northern Europe
(Also known as Gefjon)
Animal associations: Cattle (Ox)
’Giver’—Scandinavian fertility goddess. She is said to have used her sons (four oxen) to pull her mighty plough, driving up the Swedish earth to form the island Zealand, leaving behind huge holes that became the lakes of that part of the world. She is patron of both farmer and virgin. Girls who die before their first sexual experience are said to become the servants that she treats kindly in the afterlife. It has been speculated that she is an early Scandinavian form of Frigga/Frigg.
Genea—Female—Mediterranean
Husband: Genos
Phoenician first woman whose children are said to be Light, Fire, and Flame.
Genius—Male—Mediterranean
Roman ancestral and adopted spirits who protect individual men (women had the same, but it was called a Juno). With or without the man’s recognition, every man has a Genius watching over him. Should one wish to acknowledge and thank his Genius, sacrifices are made on one’s birthday. A modern interpretation of this practice can be seen in the ’Birthing Day’ presents on one’s birthday. This is where one gives his or her parents a present to give thanks for bringing one into this world. Should that parent be departed, then a sacrifice can be made in his name to a charity or cause that parent would have supported. As my father died of cancer, if I were to make sacrifice unto my Genius, I would donate to the American Cancer Society in his name. My mother, being alive today, would receive a more direct present—maybe flowers or dinner.
Genos—Male—Mediterranean
Father: Protogonos
Wife: Genea
Phoenician first man whose children are said to be Light, Fire, and Flame.
Ghede—Male—Caribbean
(Also known as Guede)
Haitian Voodoo god of the dead, the division between the living and the dead, and the sexual associations made between the two. He is god of sexual orgasm, which in French means ’little death.’ He stands at the entrance to the Underworld, the doorway between the living and the dead, and is thus associated with cemeteries. His female counterpart is Maman Brigidt. In understanding his nature, one should consider Ghede to be both his name and the name of the collective of his cohorts. His cohorts include Baron La Croix, Baron Piquante, Baron Cimetiere, and perhaps the best known, Baron Samedi. So well known is the name Baron Samedi to connect with Ghede, that the two are sometimes cited as being names for the same rather than one an aspect of the other. All souls must pass by the cross roads of Ghede before entering Guinee, the afterlife.
Gibil—Male—Mediterranean/Middle East Father: Anu
Mother: Anat
Sumerian god of both Light and Fire who is called on to protect from baneful magick.
Gilgamesh—Male—Mediterranean/Middle East
Sumerian and Babylonian folk hero who shunned the affections of Ishtar. In retaliation, Ishtar brought a seven-year drought to his land. His story is a likely source on which the story of Hercules was built.
Glooskap—Male—North America
(Also known as Glooscap, Gluskap, and Nanabozho)
Creator god of the Algonquin who treated humanity as would a loving father. Unfortunately, his brother Maslum didn’t much like that relationship. Maslum created all things baneful to humanity to disrupt his brother’s relationship. Glooskap defeated him by using trickery and lies. Their story reminds us that sometimes good people have to use less than honorable tactics to overcome opposition.
Gnabia—Male—Australia
Australian god of ascension into manhood. He is himself the challenges that cause a boy to become a man. In today’s society, he can be seen as successful completion of college, or perhaps service to the military because in his original lore, he is said to consume boys and then regurgitate only those who survived the torment, becoming men as they do. Patron of young men entering the military or college.
Gnaski—Male—North America
(Also known as Gnaska)
Animal association: Frog
Lakota spirit who drives the mind insane and the soul to paralysis. He sometimes appears as the Buffalo god to trick humanity into thinking he is friendly. For this reason, he is sometimes called ’Crazy Buffalo.’ However, a direct reference to Buffalo is not made, as it is a disguise.
Goblin Spiders—Female—Far East
Animal association: Spider
Japanese personification of mischievous/ evil creatures who by day take on the form of common spiders, but by night commit all forms of mischief and evil.
Goibniu—Male—Central Europe
(Also known as Govannon [Welsh])
Irish patron of brew masters, metal workers, and the creation of athame and sword. It is said that the swords and knives that he created would always strike and remain true, and his brew would sometimes grant immortality. Other times the brew brings only the feeling of immortality, which can typically be observed among the young men of campus-area taverns.
Gorgon, The—Female—Mediterranean
Father: Phorcys
Mother: Ceto
In Greek lore, the Gorgon may have at one point numbered many more, but they eventually settled on three horrific female creatures who were born as triplets from the union of Phorcys and Ceto. They are Euryale (’far roaming’), Medusa (’ruler’), and Sthenno (’forceful’). Their guardians are the Graiae. See also Medusa.
Gou—Male—Africa
Father: Lissa
West African Moon God.
Gou Mang—Male—Central Asia
(Also known as Kou Mang)
Animal association: Dragon
Holiday: Spring Equinox
Chinese messenger who arrives from the East to bring good news from the Sky God with each sunrise. He is associated with the Spring. His counterpart is Ru Shou.
Govannon—Male—Central Europe
(Also known as Gofannon)
Father: Beli
Mother: Don
Welsh metalsmith to the gods. Patron to metal workers, particularly those who make magickal tools.
Graces, The Three—Female—Mediterranean (Also known as The Three Charities)
Greek daughters of Zeus and Euronyme who were associated with the Muses. See Aglaia, Euphrosyne, and Thalia.
Graiae, The—Female—Central Europe (Also known as Graii, Graiae)
Father: Phorcys
Mother: Ceto
Animal association: Snake
Three old sisters of Greek lore. Each was born with gray hair and only one eye and tooth to share among the three. They were the guardians of the Gorgons (another set of three). The sisters’ names are Deino (’the dread’), Enyo (’the horror’), and Pemphredo (’the alarm’).
Great Spider—God—Africa
Animal association: Spider
Great spider is a term used in Africa to refer to spiders as a collective and in reference to gods and goddesses similar to Anansi. See Anansi.
Great Spirit—Male—North America/Central America/South America
(Also known as Manitou, Manito, Manitoo, Manitu)
Animal associations: Bison, Eagle (most common associations)
Generally speaking, Great Spirit is a Native American creator common to many tribes. The clearest indication of this is found in the Algonquin word Manitou which some translate directly to ’Great Spirit.’ However, it is also important to point out that the believe that Great Spirit is a god who was shared by all Native Americans is a New Age urban legend with little basis in fact. If we lump all Native American traditions into one category, we tend to miss such information as the Chamacoco view that the Great Spirit has a wife named Eschetewuarha. Different tribes had and have specific customs and specific gods. While there is absolutely nothing wrong with adopting traditions from several sources, claiming they were all practiced by all Native Americans is rather insulting to any person following one particular tribe’s traditions. No one person has the right to dictate the religion and spirituality of another. So in drawing on Native American or any cultural source, we should be careful not to claim that all others followed the ways we choose to adopt. That which today is generally called the Native American ’Great Spirit’ is a collective of views under which the modern interpretation of the Algonquin name have been placed. Some of the other names that have been variously translated into Great Spirit include Alowatsakima (Leni Lenape), Ha Wen Neyu (Iroquois), and Nagi Tanka (Dakota)
Green Lady—Female—Central Europe (Also known as Mother Nature, Green Jill, Jill in the Green)
Husband: The Green Man
Rarely mentioned Celtic personification of the goddess of the woods and foliage. Although the Green Man image has been cited as being found in ancient architecture, many of those faces look distinctly feminine and much of the lore of the green has given yield to deities such as Mother Nature. As she is often cited as looking much as we describe Green Man, it does seem a natural conclusion that some of those green foliage images with the face of women are just that, female versions of the Green Man, or better The Green Woman.
Green Man—Male—Central Europe (Also known as Father Nature, Green George, Green Jack, Jack in the Green)
Wife: The Green Lady
Animal associations: Goat, Elk
Plant associations: Bachelor’s Buttons, Pine Holidays: Spring Equinox, Bealtaine
Celtic personification and god of the woods and foliage who controls the rain and acts as patron over livestock of all kinds. His praise was sung far beyond the Celtic cultures. He is such a powerful concept that his images survived the Burning Times intact and can even be found on the walls and in the architecture of churches built during the persecution of Pagans by those very churches. He is seen as Father Nature.
Gronw—Male—Central Europe
Welsh god who had sex with the wife of Llew Llaw Gyffes and found out why one should not approach on monofidelity. He met a rather nasty fate in Llew’s hands.
Guaracy—Male—South America
(Also known as Guarcy)
Brazilian Sun and Creator who created all animals. One of the three Creators responsible for the world. The other two were Peruda and Jacy. In Wicca he is associated with soul and the second order of life (animal).
Gucumatz—Male—Central America
(Also known as Kucumatz)
Animal association: Snake
Mayan snake god who taught humanity the art of agriculture and negotiating with Nature.
Gui Xian—Female—Central Asia
(Also known as Kuei Hsien)
Chinese creature guardian of the North. She is described as a turtle and presides over all things that bring happiness and bliss. The other three guardians are Ch’i-lin, Gui Xian, Feng-haang, and Long. They are collectively known as the Ssu Ling.
Gula—Female—Middle East/Mediterranean
Husband: Ninurta/Enurta
Animal association: Dog
Sumerian goddess of health. Also responsible for a soul’s journey to the Underworld when sickness prevails.
Gwalu—Male—Africa
Yoruba god of rain.
Gwen—Female—Central Europe
Plant association: Apple
Celtic personification and goddess of love. She appears as a beautiful sunset or an equally beautiful woman who loves all, even when that love is not returned.
Gwion—Male—Central Europe
Animal associations: Hare, Fish, Hawk
Plant association: Corn
Welsh god who splashed three drops of the contents of Cerridwen’s cauldron onto his fingers. After licking it from his fingers, he received all knowledge. In a rage, Cerridwen chased him unrelentingly. In that chase, they both shape-shifted, assuming the appearance of animals—first as greyhound chasing a hare, then an otter chasing a fish, then a hawk chasing a bird, and a hen chasing a grain of grain.* She swallowed the grain, killing Gwion, but later gave birth to Taliesin from that seed.
*This story is sometimes told as a piece of barley or a piece of corn. Recently several postmodern authors have come under attack when referencing corn in European history because that which we call corn is a new world discovery. What folk have failed to mention is that the word corn was used in Europe to refer to a variety of grain other than what we know today as corn.
Gwydion—Male—Central Europe
Father: Beli
Mother: Don
Lover: Arianrhod (maybe sister)
Plant association: Ash
Adopted father of his sister’s (Arianrhod) virgin-born son who was later named Llew Llaw Gyffes. He created a woman out of flowers (Blodeuwedd) for his adopted son. She betrayed him with infidelity and killed Llew Llaw Gyffes after plotting with her lover. Gwydion restored him and turned her into an owl.
Gwyn—Male—Central Europe
Father: Ludd
Animal association: Owl
Note: His father is sometimes cited as Llyr.
Conducted the souls of those slain in battle through the Underworld.
Ha—Male—Africa
Egyptian personification of the deserts that brought both death and protection from invaders.
Hachiman—Male—Far East
(Also known as Yawata)
Animal association: Dove
Japanese Shinto god of war who protects the island of Japan and its people from invaders.
With the decline of war, he became a god of agriculture and fishing, helping fishermen and farmers to battle against the odds they faced. Doves are his symbols, friends, and messengers.
Hadad—Male—Mediterranean/Middle East (Also known as Baal-Hadad [Lord Thunder], Reshef [Ancient Syrian], Rimmon [Babylonian/ Old Testament], Teshub [Hittite])
Father: El
Mother: Elat
Wife: Shala
’Thunder’—Syrian god of thunderstorms and the rain they bring. He has many names in the Middle East and Mediterranean area. Perhaps most notably Rimmon who appears in the Old Testament and is later identified by authors (maybe first by Milton) as a fallen angel.
Hades—Male—Mediterranean
(Also known as Clymenus, Eubuleus, Polydegmon)
Father: Cronus
Mother: Rhea
Lover: Leuce, Minth, Persephone
Plant associations: Common Aspen, Frankincense, Hibiscus, Nettle (greater), Oak, Olive, Red Poppy, White Poppy
’Unseen’—Greek god whose name is synonymous with the Underworld. He forms a sacred Triad with his brothers Zeus (land/upper world), and Poseidon (the seas and oceans)
Incense Recipe
2 parts Frankincense
1 part Hibiscus flowers
1 part Poppy flowers
Enough Hades or Frankincense essential oil to bind
Oil Recipe
12 drops Frankincense essential oil
12 drops tincture of Hibiscus
6 drops tincture of Poppy flower
1/4 ounce base oil
Hai, Mo Li—Male—Central Asia
Mo Li Hai is the Chinese Buddhism guardian of the West. His statue is often included at the west point of Buddhist temples. In the modern practice of Feng Shui, his statue is placed in the west most part of a home to protect from negative influences coming from that direction. In Wiccan ritual, he is one of the names for the Four Quarters, the other three being Hung, Shou, and Chung.
Haket—Female—Africa
Egyptian goddess who brought life to the creations of clay by her husband’s hands, thus creating the first of humanity.
Hakini—Female—Near East
Hindu goddess associated with the Aja chakra (third eye). Sometimes described as an aspect of Shakti. See also Dakini, Rakini, Lakini, Kakini, and Sakini.
Halirrhothius—Male—Mediterranean
Father: Poseidon
Greek god who raped Alcippe. He met his death at the hands of her father, Ares.
Hanuman—Male—Near East
Father: Kasari
Mother: Angana
Animal association: Monkey
Plant associations: Benzoin, Mace, Sandalwood (white), Vervain
Hindu god of knowledge who takes the form of a monkey. His father is sometimes cited as Vayu.
Incense Recipe
2 parts Sandalwood (yellow/white) powder
2 parts Benzoin powder
1 part Vervain
Enough Hanuman or nutmeg essential oil to bind
Oil Recipe
9 drops Sandalwood essential oil
6 drops Benzoin essential oil
6 drops Nutmeg or tincture of Mace
1/2 ounce base oil
Haokah—Male—North America
Thunder god of the Sioux and Horned God of the hunt who seems to have his emotions backwards. He cries when he is happy and laughs when he is depressed. Perhaps a patron of the manic.
Hapi—Male—Africa
(Also known as Hep)
Father: Horus
Mother: Isis
Animal associations: Ape/Chimpanzee, Baboon Plant association: Water Lily
Egyptian god associated with the Element Earth and the North. Associated with the Goddess Nephthys. Patron of those with illness that affects the lungs. Wiccans who have adopted an Egyptian pantheon often associate their Quarters to align with Egyptian associations made with the Four Sons of Horus. The other three are Duamutef, Imset, and Kebechsenef.
Hapikern—Male—Central America
Mayan evil antagonist to humanity who is in constant opposition and at war with Nohochacyum. Similar in concept to the Christian view of Satan in his opposition to the Christian god.
Harek—Female—Central Europe
Animal association: Hare
German Moon Goddess equivalent to Hecate.
Harpa Khrutt—Male—Africa
(Also known as Harpa-Khruti)
Plant association: Rose
A name for Horus the Child associated with the Greek Harpocrates.
Harpies—Female—Mediterranean
Animal association: Vulture
Three Greek messengers in the form of beautiful naked women who flew through the sky with wings like birds. For reasons unknown, they later became ugly and hateful, taking on monstrous appearances. I believe the Harpies were initially seen as both characters, beautiful and ugly. They were charged with keeping the peace and when enjoying the fruits of that capacity, they were beautiful. But as history has shown, war and violence are often required to keep that peace, thus they were also sometimes seen as the necessary horrible beasts. As our view of death transformed from being identified with beauty into the hideous image that is now more prevalent, so did the view of the Harpies change. They are still considered beautiful (as is the personification of Death by some), but the view of the majority has become ugly. Perhaps a reflection on the perception of increased crime and evil in our world.
Harpocrates—Male—Mediterranean
Plant association: Rose
Greek representation of Horus the Child, often depicted as a naked male infant. He is god of keeping that which is secret and that which is silent. Interestingly enough, he is prayed to by parents who wish their children to sleep quietly through the night. Sacrifice of infant formula can be made in conjunction with these prayers by donating them to shelters and food pantries.
Ha Satan—Male—Post Modern
Animal association: Coyote
Ha Satan was not, as many folk seem to believe, an ancient deity name. The use of the name to describe a deity is strictly post-modern and in particular neo-Pagan. Although Christianity did mistake the use of the word ’Satan’ in their translations many hundred years earlier, I believe it is today’s Neo-Pagan authors who invented and perpetuate the use of ’Ha Satan.’ The best English translation of ha is ’the’ and satan is ’adversary’ or ’accuser.’ So Ha Satan is a common noun, not a name or a proper noun. In modern English context, a court room would see the prosecution as Ha Satan (the satan) to the defense and the defense as ha satan (the satan) to the prosecutor with absolutely no association or connection to good and evil unless one took sides. In which case it just means the other party that my party sides against. See also Satan.
Hastsehogan—Male—North America
Navajo god of the home and of home blessings.
Hathor—Female—Africa
(Also known as Hwt-Hert, Het-Heru, Het-hert) Animal associations: Cow, Cat, Frog, Hawk, Vulture, Lion
Plant associations: Coriander, Mandrake, Myrtle, Rose, Sycamore, Vine (grape) Holiday: Hathor’s Feast November 27th
’House of Horus’ or ’House of God’—Egyp-tian Sky Goddess. Her name refers to the house (sky) in which Horus takes flight. She was associated by the Greeks with Aphrodite. Her sacred instrument is the system, a type of rattle that usually looks like a sling shot with tiny tambourines or bells strung between the arms.
Incense Recipe
2 parts Gum Arabic
1 part Coriander
1 part Rose
A few Raisins
Haiti—Male—Middle East
Arabic Jinn who gave advice and warning, but who was never seen.
Hatmehyt—Female—Africa
(Also known as Hatmehyt)
Lover: Banebdjedet
Animal association: Fish
Egyptian fish goddess who was worshiped at the banks of the Nile, especially by fishermen.
Hay-Tau—Male—Middle East/Mediterranean Animal association: Bull
Phoenician forest god whose tears (resin) were collected and sold to the Egyptians. Frankincense, perhaps?
Hebe—Female—Mediterranean
Husband: Hercules
Plant association: Cypress
Greek goddess of youth and of boy’s ascension into manhood. Honored at rites of passage in which boys become men. She served the nectar of the gods until she was replaced by Ganymede. Some Wiccan traditions hold that she then became cup bearer to humanity. She is associated with the chalice in Wiccan ritual.
Hecate—Female—Mediterranean
Father: Perses
Mother: Asteria
Animal associations: Dragon, Dog, Frog, Hare, Snake, Toad
Plant associations: Aconite, Belladonna, Cyclamen (especially Ivy-leaved), Cypress, Dandelion, Hemlock, Henbane, Garlic, Mandrake (European), Mint, Myrrh, Oak, Onion, Palm (date), Patchouli, Sesame, Willow, Wolf’s Bane, Yew
Greek grandmother figure. She is goddess of the crossroads. Although she is sometimes associated with the Crone stage of goddess, she is typically shown as a Triple Goddess herself in that she has three faces, one a dog, one a horse, and one a snake. Her kin familiar are two ghost dogs/hounds, which are typically shown loyally by her side. Although she has been associated with the evil stereotypical with of the green skin, long nose, and warts, her story is more of the champion. It was she who rescued Persephone from the Underworld, thus restoring Spring to the world. She is prayed to for easing the suffering of birth, by those who are facing Death, and by those who have realized that both birth and death are part of life. Hecate stands at an intersection of three roads that meet. One of her faces looks each way to both welcome travelers. These three crossroads are birth, life, and death, all merging at her feet.
Incense Recipe
3 parts Sandalwood
2 parts Cypress
1 part Mint
1 pinch Belladonna (optional)
Enough Sandalwood essential oil to bind
Oil Recipe
10 drops Myrrh essential oil
6 drops Cypress essential oil
4 drops Patchouli essential oil
1/2 ounce base oil
Hehaka—Male—North America
Animal association: Elk
’Elk’—A name used today to reference a Lakota and Dakota god of the hunt. However, it is unclear if that name was used initially as a god form, as the Spirit of the Elk, or simply as a name to describe the Elk. Today, the word is used more often in reference to some of the great Earthly or formerly Earthly leaders of the various tribes and the resurgence of the Native American traditions, most notably as Hehaka Sapa (Black Elk).
Heimdall—Male—Northern Europe (Also known as Heimdallr, Gullintani) Animal association: Ram
The guardian of Asgard who requires little sleep in his duty to prevent invasion. It is told that at Ragnarok, he will kill Loki, but he dies shortly after Loki of injuries he received in the battle.
Heket—Female—Africa
(Also known as Heqet, Heka, Hekat) Lover: Khnum
Animal association: Frog
Plant association: Cypress
Egyptian goddess of Life and Death. She watches over both childbirth and the transition of the soul at death. She is depicted as either a frog or a beautiful woman with a frog’s head. In her honor, an amulet of a frog is worn by women who hope to conceive. That amulet is then hung over a child’s crib for the first year of its life that the goddess may know to watch over the child.
Hel—Female—Northern Europe (Also known as Hell)
Father: Loki
Mother: Angurboda
Animal association: Wolf
Plant association: Elder
Norse ruler of Helheim (house of Hel/ Hell), the Underworld where the souls of those who cannot rise to the Hall of their Patron/ Matron will sink at the death of their body. Her lore is rather shattering to the neo-Pagan who claim Hell is a Christian invention. One of the three children of Angurboda and Loki in which we see the number three as the number of not only good fate, but also of ill fate. The other two children are Jormungand and Fenrir.
Helblindi—Male—North Europe
Father: Farbauti
Mother: Laufey
A blind Scandinavian Underworld god. Many cite him as brother to Loki. His name is sometimes cited as an alternative name for Odin. I don’t agree.
Helen—Female—Mediterranean
(Also known as Helen of Troy) Father: Zeus
Mother: Leda
Greek woman who was so lusted after that when she became of age all the eligible bachelors (and a few ineligible) sought her hand. Concerned that should one triumph over all the others their marriage and his kingdom would be harmed by the anger of those many that did not win her hand, her step-father, King Tyndareus, gathered all the suitors and told them that none would have her hand until all swore that they would with mind, body, and soul support whom ever it would be that would have her hand in marriage. He then announced that Menelaus would have her hand. After a time, she ran off with Paris (or maybe was kidnapped), the son of the King of Troy, who had earlier wanted Helen’s hand. Outraged at the abduction, Menelaus called on the very men who had lusted after his wife but sworn the oath of King Tyndareus, to retrieve his wife from Paris. Their soldiers were rallied and the Trojan war began. With the fall of Troy, Helen returned to Menelaus. He did so love her that even if it was betrayal that caused her to leave, he welcomed her and treated her so well that she stayed with him ever more. After her mortal death, she even went to his side and remains there in the Greek afterworld in Elysium.
Helios—Male—Mediterranean
(Also known as Helius)
Father: Hyperion
Mother: Theia
Wife: Clymene, Perse
Plant associations: Cinnamon, Frankincense, Heliotrope, Sunflower
Greek Sun God who is most often depicted as an attractive young man with a golden halo or sun disk about his head.
Incense Recipe
2 parts Frankincense
1 part Cinnamon
A few unsalted sunflower seeds
Enough Helios or Frankincense essential oil to bind
Oil Recipe
12 drops Frankincense essential oil
6 drops Cinnamon essential oil
1/4 ounce sunflower oil
Hemera—Female—Mediterranean
Father: Erebus
Mother: Nyx
’Day’—Greek goddess of day. Being born of Darkness (Erebus) and Night (Nyx), she is one of the many foundations on which the Wiccan principle of ’Darkness before Light’ is based.
Henwen—Female—Central Europe
Animal association: Boar
British fertility goddess who is depicted as a pregnant boar or sow. She brought abundance and diversity to England with her many litters. Sometimes associated with Cerridwen.
Hephaestus—Male—Mediterranean (Also known as Hephaistos)
Wife: Aphrodite
Lover: Gaia
After Aphrodite was born, Zeus was concerned that there would be great battles over her hand. So he choose his trusted metal worker Hephaestus to take her hand. So much did Hephaestus adore Aphrodite, that he dedicated much of his greatly skilled work towards making her the finest jewelry and gifts. Adore is the important word here. You see, Hephaestus was greatly skilled, but he was nonetheless a working man. He felt he was blessed by Aphrodite because he never thought he could have a wife so beautiful. His story might have gone differently if he had wished instead for a lover that was compatible as well. One of those gifts was a girdle made from the finest woven gold. Unfortunately for his heart, the girdle made Aphrodite even more irresistible. With so many new suitors, Aphrodite quickly tired of her hard-working and skillful man and became content to run around with the ’bad boys’ of the time. The message here seems to be that love is fickle. His story warns that relationships in the order of marriage will not last long if they are not based on matters other then the superficial.
Hera—Female—Mediterranean
(Also known as Bopis)
Father: Cronus
Mother: Rhea
Husband: Zeus
Animal associations: Cattle, Crow, Dove, Goose, Hawk, Peacock, Sheep (ram), Snake Plant associations: Apple, Myrrh, Orris, Pomegranate, Willow
’Chosen one’—Greek goddess who warns us of inappropriate unions. Although she is a goddess of marriage and birth, her story is a warning to mismatched couples. Her marriage to Zeus can only be said to remain intact due to conflict theory, for most of her stories involve her jealous rage being vented on Zeus’ many lovers and their many children born of Zeus. As patron of marriage, her story speaks volumes about compatibility. She tell us that folk inclined towards monogamy should be wed to those inclined to monogamy. Those not inclined to monogamy should marry those not inclined to monogamy. She is strongly associated with Juno.
Incense Recipe
2 parts Sandalwood (Yellow)
· 1 part Myrrh
· 1 part Orris root
Hercules—Male—Mediterranean
(Also known as Herakles, Heracles)
As Hercules:
Father: Jupiter
Mother: Alcmene
Step-mother: Juno
As Heracles:
Father: Zeus
Mother: Alcmene/Alcmena
Step-mother: Hera
Animal association: Deer
Here I have listed the Greek and Roman together because both names and stories overlap so well. Greek and Roman folk hero. Known to bless gay unions. His story takes the story of Hera one step further. Where here story reflects on the ill fate of a couple whose partners are not well suited, the story here is that the children of such ill-suited partnerships are the ones who commonly suffer. Told variously in his Greek and Roman tales, his stepmother tried to kill him at birth, tormented him throughout his life, and finally drove him insane. Finally reaching council (perhaps a modern interpretation of a psychologist) with an oracle, he was given several tasks, the completion of which would restore sanity.
Hermaphrodite—Male—Mediterranean Lover: Dionysus
Greek god who united with Salmacis to become one body. From this union of male and female to form one body, we derive the modern use of the word hermaphrodite. Although many cite him as an example of a gay deity because he has the gender of both man and woman, it is hard to say that his relationship with Dionysus supports that stance. Instead, it seems to state that Hermaphrodite was bisexual.
Hermod—Male—North Europe
Father: Odin
Wife: Frigga
Scandinavian messenger of the gods who risked death to assure the safe return of his brother Baldur. He speaks volumes on the subject of brotherly love and self sacrifice.
Hermes—Male—Mediterranean
(Also known as Enagonios)
Lover: Aphrodite, Hecate, Carmenta, Persephone
Animal associations: Cock, Cattle (cow), Goose, Sheep (lamb), Hare, Lizard, Tortoise, Turtle
Plant associations: Almond, Beech, Benzoin, Gum Mastic, Hazelnut, Mace, Olive, Sandalwood (white), Vervain
Greek messenger of the gods and deity of intellect, higher learning, communication, commerce and travel. He is the patron of merchants and of the self employed. Interestingly enough, he is also patron of thieves, perhaps a reflection on the cunning necessary to keep a thief alive in a time when the profession was sometimes punishable by death. Historically and today, he is called on to bless homosexual relationships.
Incense Recipe
· 2 parts Sandalwood (yellow/red) powder
1 part Benzoin
1 part Gum Mastic
Enough Hermes or Sandalwood essential oil to bind
Oil Recipe
9 drops Sandalwood essential oil
6 drops Benzoin essential oil
6 drops tincture of Gum Mastic
1/2 ounce olive oil
Herne—Male—Central Europe
Animal association: Bear, Wolf, Bull, Otter, Sheep (ram), Deer (stag), Goat
Plant association: Juniper, Oak, Patchouli, Pine
Celtic Horned God of the hunt who represents the hunter, the hunted, and the connection between both. He is, in essence, the connection or mediator between Life and Death. From his lore, we see the Wiccan principle that for Life there must be Death. See also Cernunnos.
Incense Recipe
4 parts Patchouli herb
4 parts pine needles (or 1 part pitch and 3 part sandalwood)
2 parts Gum Arabic
Enough Herne oil or a mixture of patchouli and pine oil to bind
Oil Recipe
9 drops Patchouli essential oil
6 drops Pine essential oil
6 drops Juniper essential oil
1/2 ounce base oil
Hestia—Female—Mediterranean
Father: Cronus
Mother: Rhea
Greek goddess of the warmth in a home. Her altar is the hearth where family members gather to worship her with mutual love for each other. Such is her conviction to remain virgin, that she rejected the courting of both Apollo and Poseidon himself, swearing on the head of Zeus that she would now and forever more remain virgin. As you can probably guess, her Roman equivalent is Vesta.
Himavat—Male—Near East/Central Asia (Also known as Himavan)
’Snow top’—Hindu personification and god of the Himalayas.
Hine Au One—Female—Polynesian Islands (Also known as Kane [Hawaii]) Plant association: Bamboo
Polynesian first woman, molded out of clay by her father Tane. Without knowing he was her father, she welcomed him to her bed and bore him one daughter, Hina Titama. Upon discovering her lover was also her father, she fled to the Underworld in the shame of her incest.
Hino—Male—North America
Iroquois god of thunder who fought against the original inhabitants of North America. Described as giants, this could be one of the many surviving hints that European migration occurred much earlier than currently thought.
Hinokagu—Male—Far East
Father: Izanagi
Mother: Izanami-No-Kami
Japanese Fire god and patron of those seeking sudden change.
Hit—Female—Micronesia
Animal association: Octopus
Octopus goddess who is prayed to for assurance of safe passage over the ocean.
Hjordis—Female—North Europe
Husband: Sigmund
See Sigmund for her story.
Hulda—Female—Central Europe/Northern Europe
(Also known as Holda, Bertha and maybe Holle)
Animal association: Dog, Goat, Goose, Hare, Spider
Plant association: Elder, Flax, Hellebore, Rose
’The Benignant’—Initially a German goddess who began as Hulda, a beautiful young maiden. Gradually, she became a guardian of marriage. Her lore then grew into Bertha, and she is said to tend children as would a grandmother. She is also the terror of children who have been bad or who have committed evil deeds. Her lore spread to most of Europe. She is patron to everyone who has ever been bullied in school. Along the way, she became a wonderful example of the principle of Maiden, Mother, and Crone as seen in the Triple Goddess.
Hoder—Male—North Europe Father: Odin
Scandinavian god of the night who was born blind.
Honos—Male—Mediterranean
Roman god and personification of morality and ethics, especially those in the course of conflict. Speaks to us of conducting ourselves within personal ethics and social morals, even when it seems setting those things aside might quicken victory.
Hora—Female—Mediterranean
Husband: Quirinus
Animal association: Butterfly
Roman goddess of both time and beauty. Perhaps a reflection on the fading of beauty as one gets older.
Horae—Female—Mediterranean
Father: Zeus
Mother: Themis
’The Hours’—Three Greek sisters who kept track of time and the seasons. Individually, they are Dike (natural law/justice), Irene (peace), and Eunomia (order)
Horus—Male—Africa
(Also known as Hrw, Hr)
Egyptian word, which is misunderstood to be reference to a specific deity. In essence, this word denotes any one of several different deities, most notably Horus the Elder and Horus the Younger.
Horus The Elder—Male—Africa
(Also known as Heru-ur)
Father: Geb
Mother: Nut
Animal associations: Antelope, Cat, Falcon, Goose, Hawk, Dragon, Wolf
Plant associations: Dragons Blood, Horehound (white), Nettle (greater), Oak, Pepper (black), Rose, Rue, Sunflower, Water Lily, Wormwood, Yarrow
Egyptian god.
Incense Recipe
2 parts red rose petals and buds
1 part Yarrow flowers
1 part Dragon’s Blood resin
Enough Horus oil or Otto of Rose to bind
Oil Recipe
9 drops Dragon’s Blood perfume oil
6 drops Otto of Rose
6 drops Yarrow essential oil
1/2 ounce Sunflower oil
Horus The Younger—Male—Africa
(Also known as Heru-sa-Aset)
Father: Osiris
Mother: Isis
Animal associations: Cat, Goose, Hawk
Plant associations: Dragon’s Blood, Water Lily
The use of the word Horus to describe the Horus that is son of Isis. This is the most popular use of the term Horus to describe an Egyptian god form. He is often depicted suckling his mother’s breast or standing as a young child between Osiris and Isis.
Hou-Chi—Male—Central Asia
(Also known as Hou Ji)
Chinese hero who taught farming and the negotiation with Nature.
Hsi Wang-Mu—Female—Central Asia (Also known as Xi Wang-mu) Father: Yu-huang
Husband: Mu Gong
Animal association: Tortoise
Chinese Taoist personification of the female principle of the soul (the yin). She is called the ’Royal Mother of the West.’ She is goddess of immortality and presides over the western half of Paradise in the afterlife.
Hu—Male—Africa
Egyptian god who was born from a drop of Ra’s blood. He is the embodiment of duty corresponding to authority. He is the patron of anyone who must follow orders once they are given and can be called on to assist in following through with matters that are necessary but perhaps not pleasant.
Hu Gadarn—Male—Central Europe
Welsh hero who taught farmers how to plow. He is most noted for his instruction of the use of rhyme and song to improve memory, which is later reflected in the Wiccan Rede as ’To cast ye spell well every time, let that spell be spake in rhyme.’ Many cites state that Hu Gadarn is another name for Cernunnos/ Herne.
Huitzilopochtli—Male—Central America (Also known as Uitzilopochtli)
Mother: Coatlicue
Animal association: Hummingbird, Snake
Aztec god of storms and wars who was born in a full suit of armor. Although he was honored with human sacrifice, he was also the protector of peaceful travelers. The association with human sacrifice is centered in his mother’s death. See Coatlicue.
Hunab Ku—Male—Central America
Mayan Creator god. He created three worlds, each with its own people. The first and second were destroyed by other than his hand, so he tried again and again. We now live in the third world of his creation, but our destruction is foretold. At that point he will create anew. This is, perhaps, a commentary on ages of humanity that preceded our current age. It is interesting to note that occasionally there is found anomalies that simply do not fit with our current thinking on the way humanity evolved; metal projectiles reportedly found in dinosaur skulls, near perfectly machined spheres dug from stone that dates to millions of years, and others boggle archeologists. While I am not stating that these many anomalous finds are fact, they certainly make a person wonder, especially with lore such as this.
Hung, Mo Li—Male—Central Asia
Mo Li Hung is the Chinese Buddhism guardian of the South. His statue is often included at the south point of Buddhist temples. In the modern practice of Feng Shui, his statue is placed in the south most part of a home to protect from negative influences coming from that direction. In Wiccan ritual, he is one of the names for the Four Quarters, the other three being Shou, Chung, and Hai.
Hu Nonp—Male—North America Animal association: Bear
Lakota Bear God who is patron of wisdom.
Hun-Tun—Male—Central Asia
Chinese god form similar to the Nameless One from the Book of Genesis. A better equation would be to Diana before separating into Light and Dark. Here the same story is told, except instead of Light and Dark or male and female, Hun-Tun predates Yin and Yang.
Huruing Wuhti—Male—North America
Hopi Creator god, of which there were two.
Hygeia—Female—Mediterranean (Also known as Hygieia)
Father: Asklepios
Animal association: Snake
Greek goddess of health, healing, and the maintaining of that health with hygiene. So inseparable is this goddess from the concept that good personal hygiene is essential to health that the word itself, hygiene, is based on her name. Her symbols has survived today in the symbol of medicine. There we still see her sacred snake and the rod of her father, Asklepios.
Hymen—Male—Mediterranean
(Also known as Hymenaeus)
Father: Dionysus
Mother: Aphrodite
Plant association: Hawthorn, Juniper, Olive, Vine (grape)
Greek god who blessed marriages and the receptions that follow. Keep in mind who his parents are prior to calling on him for assistance. He is also patron of celebrating anniversaries and is most applicably called on when one wants an anniversary to rekindle a lustful spark. Patron of marriages and celebrations of marriage.
Incense Recipe
3 parts Sandalwood (yellow/white) powder
2 parts Hawthorn berries
2 parts juniper berries
1 part raisins
1 part Gum Arabic
Enough Hymen oil or red wine to bind
Oil Recipe
9 drops Juniper essential oil
1 teaspoon tincture of Hawthorn berries
1 pinch sugar (dissolve first into the tincture of Hawthorn berries)
1/2 ounce grape seed oil
1/2 ounce olive oil
Hyperion—Male—Mediterranean
Father: Uranus
Mother: Gaia
Lover: Theia
’He who goes before the sun’—Greek god whose children are Helios (the son), Selene (the moon), and Eos (the dawn). As father of the son, his name is support for the Wiccan principle that darkness comes before light.
Hypnos—Male—Mediterranean
Plant Association: Poppy (especially white)
Greek personification and god of sleep from whom we receive the word hypnosis. Ensures a restful sleep and sends his son Morpheus to bring the sleeper dreams. Also responsible for peaceful transition into death, for he could also send his son Thanatos. Patron of euthanasia and dreams.
Iah—See Aah
Iasion—Male—Mediterranean
(Also known as Iasius)
Greek god who is associated with fertility rites at Spring Equinox and Bealtaine. The association is probably made from records that Iasion and Demeter were involved in such fertility rites. Patron of fertility and male sexual virility.
Ibey—Male/Female—African/Caribbean/ South America
In Santeria, they are called The Jimaguas/ Ibey/Omo-Melli
In Voodoo, they are called The Marrasa
In Africa, they are called the Ibeji (twins) Saint and Catholic associations (in pairs): St. Cosme and St.Damian, St. Crispin and St. Crispinian, St. Justa and St. Rufina
Holiday: Feast of Saint Cosme and Saint Damian on September 27
’The twins’ (loosely)—The twins, named Taebo (male) and Kainde (female), are seen as messengers of the gods and good omens. Wood statues are given as presents to bring good luck to a home (especially at weddings). Although they are both male, the modern tradition of placing a statue of the groom and bride atop a wedding cake may come from the African tradition of giving Ibeji statues to a couple as wedding presents. They are the playful patrons of children.
Ictinike—Male—North America
Sioux son of God who was cast from the heavens down to Earth due to his deceit and challenges to his father, the Sun God. Much like the Christian Satan, he is known for his lies and deceit.
Idris—Male—Central Europe
Welsh giant who knew the day, the morrow, and each day until end day from his careful study of the stars and heavenly bodies. He is patron of both poet and madman, for it is said that should a man spend one night in his chair that man would become the greatest of one of the two.
Igaluk—Male—Arctic North America
Animal associations: Fish and all sea creatures
Eskimo moon god. In some traditions he is seen as supreme god and All Father. In a much smaller capacity, he is sometimes linked to the Inuit god Aningan in and around Greenland. I believe this link is only made because they are both seen as moon gods and not for any attribute that they share.
Igraine—Female—Central Europe (Also known as Igerna, Yguerne, Igrayne) Husband: The Duke of Cornwall, Uther Pendragon
In Arthurian legend, she is the wife of the Duke of Cornwall and mother by he of Morgan la Fay. Later, she married Uther Pendragon, whose army had killed her husband, after conceiving his child, King Arthur.
Ihy—Male—Africa
Father: Horus (sometimes listed as Ra) Mother: Hathor
Egyptian god who was particularly skilled with the sistrum, a musical instrument sacred to his mother, Hathor. Patron of musicians, especially string instruments.
Ikto—Male—North America
Sioux inventor and personification of human speech, as well as the many languages of North America.
Iktomi—Male—North America/Lakota
(Also known as Unktomi)
Animal association: Spider
Lakota spider god who brought culture to the Lakota. He is sometimes seen as a trickster who plays jokes on the young in the hopes that the tricks will bring about an understanding of the cultural principles known by their parents. Associated with the Sioux, Ikto but not interchangeable.
Ilmaqah—Male—Middle East
Early Semitic moon god.
Imhotep—Male—Africa
(Also known as Imhetep)
Father: Ptah
Mother: Nut
Egyptian man who is believed to be the first to use cut and shaped stones for the creation of buildings. His best-known example is the first pyramid (Step Pyramid). Due to the great work during his lifetime, he was deified after his death and given a spot in the lineage of the Egyptian pantheon of gods, thus becoming the son of Ptah and Nut posthumously. Patron of the skilled working class.
Imset—Male—Africa
(Also known as Amset, Mesti, Mesta)
Father: Horus
Mother: Isis
Egyptian god associated with the Element Water and the South. Associated with the goddess Isis. Patron of those with illness of the liver. Wiccans who have adopted an Egyptian pantheon often associate their Quarters to align with Egyptian associations made with the Four Sons of Horus. The other three are Duamutef, Hapi, and Kebechsenef.
In—Female—Far East
Japanese principle of the feminine portion of the soul. Similar in idea to the better-known Chinese Yin.
Inanna—Female—Mediterranean (Also known as Inannu) Father: Ea
Mother: Kishar
Lover: Dumuzi
Animal associations: Dog (especially hunting dogs), Lion, Snake (serpent)
Holiday: The Nativity of Inanna on January 2nd
Sweet Inanna is the most important goddess in the Sumerian pantheon. Although predominantly a goddess of love and fertility, she is also a goddess of war, especially when love and fertility are threatened. One of her dominant stories parallels the story of Persephone in many ways. In that story, she traveled to the Underworld and declared herself its ruler. That didn’t sit too well with her sister Ereshkigal, who had already secured that title. Ereshkigal killed Inanna for her insolence. With the death of Inanna came the death of love and fertility, so the world suffered and begged of the god Enki that she be restored. He negotiated with Ereshkigal, who conceded that Inanna could return to the world of the living only if she made sacrifice of her beloved Dumuzi. She did. That sacrifice is repeated every year, and from that sacrifice we have Winter and Summer. During the Summer, she is in the world of the living bringing love and fertility, but her lover is in the Underworld. During the Winter, she replaces him there (self-sacrifice), and her beloved is allowed to leave.
Inari—Male—Far East
Animal associations: Fox, Spider Plant association: Rice
Japanese god of prosperity, farming, and harvest. He was also a revered swordsmith. Wiccans associate him with the blessing of the athame, often including rice within the box that stores the athame. Patron of farmer and metal smiths (tools/weapons) and one who gives lessons and punishment to folk of evil ways.
Indra—Male—Near East
Father: Dyaus
Mother: Prithvi
Animal associations: Cattle (bull), Eagle, Hawk, Elephant (white), Horse, Dog (hunting dogs), Snake (cobra), Bee, Dragon Plant associations: Aloe, Cedar, Olive, Orange (sweet), Saffron (Spanish)
Hindu god of war, whose wisdom was expressed in a conversation with his boyhood friend Arjuna, as recorded in the Bhagavad Gita. In the Hindu pantheon, Indra is one of the gods who favored communication with humanity. He is confidant, advisor, and guide to humanity, especially when confronting matters where one’s true will comes into question. Patron of all who would seek their place in life (true will). One of the eight Hindu guardians of the principle directions. Indra is the guardian of the East. The other seven are Agni, Yama, Surya, Varuna, Vayu, Kubera, and Soma. Indra is also one of the Adityas. The Hindu month Asvini (September 23-October 22) is sacred to Indra. See Adityas.
Incense Recipe
Peel an orange and sprinkle the peel with saffron. Place the peel in a warm, moist, and dark place. Keep it damp by spraying a weak mixture of warm water (not hot) and honey on the peel each day. After a month, a mold will form on the peel. This mold is the incense or tincture base, not the peel itself. Scrape the mold, dry it, and burn as an incense powder.
Oil Recipe
12 drops Cedar Wood essential oil 9 drops Petitgrain essential oil 1/2 ounce olive oil
Inktomi—Male—North America
(Also known as Iktomi)
Animal association: Spider
Lakota spider god who established the Lakota community and culture. He is also a trickster who teaches children much needed lessons on matters of community.
Inle—Male—African/Caribbean/South America
Saint and Catholic association: Archangel Raphael
Holiday: Feast of the Archangel Raphael on October 24th
Yoruba god of fishing who, upon his migration into Santeria, became a god of healing. He is the owner with Ochun of the rivers and fish from those waters. He is patron of doctors and fishermen.
Io (1)—Female—Mediterranean
Animal association: Cow
Greek priestess who was beloved by Zeus. Of course, that meant Hera made her life miserable. In this case, Zeus turned her into a cow to escape Hera’s rage. Of course, Hera didn’t fall for it and hounded the poor thing even as a cow.
Io (2)—Male/Female—Polynesian Islands (Also known as Kiho)
Supreme Creator on several of the Polynesian Islands (not all). Actually a marriage of Te Io Ora (male) and Io Wahine (female), but it is important to note that neither was seen as an individual. Te Io Ora can be seen as the Yang or masculine principle of Io, and Io Wahine can be seen as the Yin or the feminine principle of Io.
Ioskeha—Male—North America
Iroquois/Huron Creator god who taught humanity how to negotiate with Nature. He was in opposition with his brother Tawiskara, who created nothing but evil. Patron of farmers and others in negotiation with Nature.
Irene—Female—Mediterranean
(Also known as Eirene)
Animal association: Dove
Plant association: Olive
’Peace’—Greek goddess of peace and personification of wealth. Often depicted with a cornucopia, scepter, and torch. Her lore tells us that peace is achievable when all sides have wealth, warning that war is often the result of poverty and imbalance. She is one of the Horae with her sisters Dike and Eunomia.
Iris—Female—Mediterranean
Father: Thaumas
Mother: Electra
Plant associations: Iris, Orris Root, Rose, Wormwood
’Rainbow’—Greek personification of the rainbow for which the colored portion of our eyes is named. She is the winged messenger who brings messages from the gods (especially Hera) to humanity. With the modern association of the rainbow to the message brought forth by both the gay, lesbian, bisexual community and the Rainbow Coalition, we might see in her the message that communication with the gods comes in all colors and preferences.
Ishtar—Female—Middle East/Mediterranean Father: Anu, Sinn
Mother: Anat
Lover: Marduk, Asshur
Animal associations: Lion, Snake (serpent), Dragon, Dove, Cow (calf), Scorpion, Hedgehog, Dolphin, Fish
Plant associations: Acacia, Apple, Juniper and all grains (especially Wheat)
Note: Due to the merging of the Sumerian and Babylonian pantheons, her mother and father are often cited completely differently.
Sumero-Babylonian goddess who inherited the attributes and stories of the moon goddess Nuah. One of the most noted stories that was adopted was that of her involvement in the Great Flood. Although exactly what Ishtar/ Nuah complained about is not recorded, some speculate that it was issues concerning humanity’s procreation or migration. In response to the complaint, the gods decided to destroy great amounts of humanity with the Great Flood. As the story comes originally from the moon goddess Nuah and as the moon controls the tides, we can see a connection in this story to Ishtar being responsible for the flood.
Isis—Female—Africa
(Also known as Aset)
Father: Seb
Mother: Nut
Animal associations: Cat, Cow, Dove, Goose, Hawk, Swallow, Peacock, Antelope, Vulture, Deer, Snake (cobra), Scorpion, Dolphin, Fish, Dog
Plant associations: Barley, Frankincense, Heather, Iris, Myrrh, Onion, Orris Root, Palm (date), Persea, Rose, Vervain, Wheat, Wormwood
Egyptian sister and wife to Osiris. She has been seen as Mother Goddess, with Horus on her lap or suckling at her breast. She has been seen as Sun Goddess, with the solar disk on her head. She has been seen as the seat of royalty, often shown with a throne on her head. Perhaps a comment on a wife’s role as seat (comforter) of her husband. She is one of the popular goddess images in modern Pagan culture.
Incense Recipe
2 parts Frankincense
2 parts Sandalwood
1 part Myrrh
· 1 part Heather flowers
Enough Sandalwood oil to bind
Iskur—See Addad
Ison—Female—Africa
(Also known as Eka Obasi, Obasi Nsi, Ibibio, Ekoi)
Animal Association: Tortoise
West African fertility goddess. She is strongly associated with both Earth and Water.
Itokaga—Male—North America (Also known as Okaga) Animal association: Lark
Lakota word that literally means ’South’ or the power of prayer sent to the South. Personification of South.
Itzamna—Male—Central America
(Potentially also known as Kinich-Auau) Father: Hunab Ku
Lover: Ixchel
Animal association: Lizard, Jaguar
Mayan creator of community, moon god, and teacher of the written language. Patron of teachers and educators. He is called ’Lord of knowledge’ and is said to have either invented or instructed in the Mayan calendar.
Itzpaplotl—Female—Central America Animal association: Butterfly
Beautiful Aztec goddess associated with the door between Life and Death. Although she is portrayed as most healthy and attractive, her face reveals symbols of death. She is yet another example of the connection between sex and death or Life and Death.
Iwazaru—Male—Far East
Animal association: Monkey
’Speak no evil’—There is a 17th century temple in Japan which has a statue of three monkeys. The best translation of the inscription on that statue is ’See no evil, hear no evil and speak no evil’ or ’Mizaru, Kikazaru, Iwazaru.’ The statuary is most likely a representation of the three faces of a much earlier deity form, Vadjra.
Ix—Male—Central America
Father: Itzamna
Mother: Ixchel
One of the Bacabs, the four Mayan gods of the principle directions. Associated with the color black. In Wiccan ritual he is associated with the West Quarter. See also Cauac, Kan, and Mulac.
Ixchel—Female—Central America
Potentially equivalent to Ixalvoh
Husband: Voltan
Lover: Itzamna
Mayan moon goddess and patron of pregnant women. She invented the art of weaving and taught that art to humanity, as did her lover Itzamna teach in many of the other arts of community.
Ixtlilton—Male—Central America
Aztec god of health, medicine, and healing magic, especially for children. He is patron of children, feasting, and games. An example of the connection between revelry and games found outside of the Greek pantheon.
Izanagi—Male—Far East
Wife: Izanami
’Man who invites’—Japanese Shinto sky god, with his wife Izanami, responsible for creating the island of Japan. When his wife died, he went to the Underworld to retrieve her. She would not return, believing she was where Fate had placed her. Upon his return, he washed himself to remove anything remaining from the Underworld. In that cleansing rite, he washed his left eye. In so doing, he created the Sun Goddess Amaterasu. He washed his right eye and in so doing created the moon goddess Tsuki-Yumi. He blew his nose and in so doing created the Storm God Susanowa who, with his falling rain, became god of the oceans.
Izanami—Female—Far East
Husband: Izanagi
’Woman who invites’—Japanese creator. See Izanagi.
Jacy—Male—South America
Brazilian moon god who created all plant life. One of the three Creators responsible for the world. The other two were Peruda and Guaracy.
Jagannatha—Male—Near East
Hindu god whose name is often used to reference Krishna births and from which originated the term ’juggernaut’: “Something, such as a belief or institution, that elicits blind and destructive devotion or to which people are ruthlessly sacrificed.” (The American Heritage Dictionary of the English Language, Fourth Edition). The word juggernaut was an offshoot of the god’s name used to describe a structure (car or cart) used to transport the new bride (sacrifice?) of Jagannatha each year. So large was the structure that it had 16 wheels and took 50 men to move. As the procession traveled to the temple, devotees hurled themselves to a certain death under its wheels believing such a death would favor them in the afterlife. He is considered the patron of those who wish to be slaves and while slavery may not sound like an admirable aspiration, Wicca speaks greatly of free will and self determination. The story of Jagannatha thus speaks to us of allowing those who wish to serve to be afforded the right to do as they please. Where we might become angry with the mindless ranting of sidewalk ministries, those who honestly wish to follow blindly should be allowed to do just that. In the words of Aleister Crowley, “The slaves shall serve.”
Jana—Female—Mediterranean
Husband: Janus
Roman moon goddess. She is patron of the process of change, of walking through doorways. With her husband Janus, she is the foundation for the word that is the month of January.
Janus—Male—Mediterranean
(Also known as Ianus)
Wife: Jana
Plant associations: Oak, Olive
Roman oak god who evolved from Dianus and from whose name we receive January, the month sacred to Janus. He is the guardian of transition and doorways who is often depicted with two faces, one looking forward and the other looking back.
Jehovah—Male—Middle East
(Also known as Yahweh)
’Lord’ or ’God’—The name Jehovah has come to mean either ’Lord,’ ’God,’ or ’Lord God’ without respect to specific pantheon. However, the use of this name is a modern use based on a mistaken translation. The original Hebrew was written Yhvh, because ancient Hebrew had no vowels. After generations in which it was forbidden to speak the name, vowels were added. Although no one could know what the original word sounded like, they created the word Yehova, which eventually found its way into English as Jehovah. See Yahweh.
Jesus—Male—Middle East
(Also known as Christ, Yeshue)
Father: Yahweh
Mother: Virgin Mary
Wife: Mary Magdalene
Animal association: Fish
Plant association: Holly
Holiday: Christmas on December 25th/Easter (date changes with the year)
An avatar/incarnation of Yahweh who was born of a willing virgin without the act of sexual intercourse with Yahweh. In this incarnation, Yahweh removed the original sin (rape) from humanity by allowing himself to take earthly form and then be violated in much the same way Mother Earth was when under his orders she was raped to create Adam. See Adam and Yahweh.
Jikoku—Male—Far East
Japanese god subordinate to Taishaku-ten who guarded the East. In Wiccan ritual, he is sometimes connected with the East Quarter. The other three were Komoku, Zocho, and Bishamon.
Jok—Male—Africa
(Also known as Jok Odudu)
Animal association: Goat (black)
’Creator’—All Father and Creator to the Alur (tribe of the Uganda/Zaire area).
Jormungand—Male/Female—Northern Europe
Norse serpent who will kill Odin in the end time. Jormungand dies too at that conflict. One of the three children of Angurboda and Loki in which we see the number three as the number of not only good fate, but of ill-fate.
The other two are Fenrir and Hel. Note that sometimes Jormungand is cited as male and other times as female.
Julunggul—Female—Australia
Animal association: Snake
Rainbow goddess of the Aboriginal Australians. She is patron of children and presides over their transition and initiation into adulthood.
Juno—Female—Mediterranean
(Also known as Juno Februa, Regina [Queen]) Father: Saturn
Husband: Jupiter (also brother)
Animal associations: Eagle, Goose, Peacock, Vulture
Plant associations: Crocus, Date (fig), Lily, Lettuce (especially wild), Mint, Pomegranate, Quince, Vervain
Roman state goddess who is associated more with national or state matters than with individual needs. To her are sacred the months of June and February. She was seen as the Queen of Rome and thus presided over litigation between Rome and other nations. She is patron and protector of women and the rights of women, but generally not the individual woman. Here is where it gets tricky. Juno is also the word used to denote a protective spirit for an individual woman. The male equivalent is Genius. These spirits are usually ancestral, but there is nothing stating that such spirits are above adoption rites. See Genius for more information.
Jupiter—Male—Mediterranean
(Also known as Dies Pater [’Shinning Father’], Ivppiter, Jove, Optimus Maximus [’All Good’]) Wife: Juno, Minerva
Animal associations: Eagle, Goat, Sheep, Woodpecker
Plant associations: Acorn, Agrimony, Almond, Aloe, American Aspen, Beech, Cassia, Carnation, Cedar, Common Aspen, Cypress, Daisy (Ox-eyed), Fig, Gorse, Hyssop, Leek, Mullein, Oak, Olive, Orange (sweet), Palm (date), Pine, Sage, Vervain, Violate
Roman Supreme God, identified with the Greek Zeus, who is known by many names in accordance with his many functions of state. Like his wife Juno, he is a state god. While oaths are often sworn to him, he is more concerned with matters of the community as a whole rather than individual needs. Some of his many names and the roles that they play:
Jupiter Caelestis—The All or Heavenly Father Jupiter Lucetius—The god of light and sun that blesses crops
Jupiter Totans—The god of thunder (also nourishing rains)
Jupiter Fulgurator—The god of lightning (also nourishing rains)
Jupiter Victor—The god of victory
Incense Recipe
· 2 parts Orange peel powder
1 part Cypress
1 part Carnation flowers
1 part Gum Arabic
Add a bit of dried fig (optional)
Enough Jupiter or Cedar wood essential oil to bind
Oil Recipe
9 drops Galbanum essential oil
6 drops Cypress essential oil
6 drops Cedar Wood essential oil
1/2 ounce Almond oil
Jurupari—Male—South America
Brazilian god and patron of men’s mysteries. His rituals were so guarded from women that there are more than a few accounts of women being put to death for haven intruded upon them.
Justitia—Female—Mediterranean
Roman goddess of justice. She is most often recognized as the blindfolded goddess who holds scales in one hand and a sword in the other. Her statue is found in many buildings of law and justice in the modern world. Previously she was depicted with a scale in one hand and a cornucopia or horn of plenty in the other, as if to note that only the just would receive plenty. This is in keeping with the Wiccan principle found in the Rede that instructs that one should fairly take and fairly give, not support hand-outs to those who are not deserving.
Juturna—Female—Mediterranean
Roman goddess of wells and the springs that feed them.
Juventas—Female—Mediterranean
Roman goddess of youth who is associated with the ascension into manhood. During such rites, boys would sacrifice a coin to her. Very similar to the Greek Hebe.
Kaikias—Male—Mediterranean
Greek personification of the North West Wind. See Book of Four.
Kakini—Female—Near East
Hindu goddess associated with the Ahahata chakra (heart). Sometimes described as an aspect of Shakti. See also Dakini, Rakini, Lakini, Sakini, and Hakini.
Kali—Female—Near East
(Also known as Kalika)
Husband: Shiva
Animal associations: Cow, Snake, Jackal, Raven
’Black one’—Hindu avatar/incarnation of Parvati who brings what can best be described as dissolution. Some are quick to point out that dissolution and Kali are Death. While it is true that the word dissolution can indeed mean death, it also indicates the fragmenting of a thing. In that we see a very different story. Kali becomes almost Zen-like. Dissolution also indicates the sensual pleasures, also attributed to Kali. Yes, she is the destroyer. But in that attribute, she is the destroyer of ignorance who frees the mind of men who seek to know god by allowing the dissolution of god such that the illusion cast upon such a force by cultural norms does not interfere with the understanding of the truth.
Kalki—Male—Near East
Animal associations: Horse, Peacock
’Time’—Hindu 10th and last avatar of Vishnu, foretold but not yet born. He will come from the sky, riding a great horse down to Earth where he will begin the great battle which will eventually kill all who are unrighteous. In the process, the world as known today will be destroyed, but Kalki will build a new world. One that is free of evil.
Kama—Male—Near East
Father: Vishnu
Mother: Lakshmi
Wife: Rati
Animal associations: Bee, Parrot
Hindu god of romantic love. He is seen as a winged messenger with bow and arrows, similar to Eros. His wife’s name is Rati (’pleasure’). Together their names are united as ’Kama Rati’ to describe the sexual unions of people who are deeply in love. This is one of the secret names for the Great Rite in Wiccan Ritual when the love and erotic passion of the host/ priest and hostess/priestess is practiced in the form of coitus. From his name comes the title of the book Kama Sutra. Written in Sanskrit, the Kama Sutra provides rules for sensuous and sensual pleasure, love in the order of the erotic, and marriage in accordance with the Hindu laws of the time.
Kan—Male—Central America
Father: Itzamna
Mother: Ixchel
One of the Bacabs, the four Mayan gods of the principle directions. Associated with the color Yellow. In Wiccan ritual he is associated with the East Quarter. See also Cauac, Ix, and Mulac.
Kanaloa—Male—Islands
Animal association: Octopus
Plant associations: Banana, Kava Kava
Hawaiian Creator god. Although he created Above and Below, he is today associated mostly with the Underworld, leaving the others in his pantheon to dictate the lives of men. He is depicted as a giant octopus.
Kanati—Male—North America
(Also known as Kana’tu)
Wife: Sheu
’Lucky Hunter’—Cherokee god of the hunt and of tools of the hunt.
Kane—Male—Polynesian Islands
Plant association: Kava Kava
Hawaiian All Father who created all of humanity. He created the three worlds, Land, Sea, and Sky (the heavens).
Karma, Dakinis—Female—Central Asia
Dakinis Karma is the Tibetan goddess associated with the North, sternness, and impartiality. See also Vajra, Ratna, Padma, and Buddha.
Karttikeya—Male—Near East
(Also known as Skanda, Muruhan, Subramanya, Kartikeya)
Animal association: Peacock
Hindu god of war and male virility. He commands the armies of Heaven and rides a giant peacock into battle where his six heads and 12 arms make him master of the bow in combat.
Kashyapa—Male—Near East
(Also known as Kasyapa)
Lover: Aditi
With Aditi, he is the Hindu father of the Adityas (the months). See Adityas.
Kebechsenef—Male—Africa
(Also known as Qebesenuf)
Father: Horus
Mother: Isis
Animal association: Falcon
Egyptian god associated with the element Air and the West. Associated with the Goddess Selkhet. Wiccans who have adopted an Egyptian pantheon often associate their Quarters to align with Egyptian associations made with the Four Sons of Horus. The other three are Duamutef, Hapi, and Imset.
Kephra—Male—Africa
Animal associations: Dolphin, Fish, Ram, Scorpion, Turtle, Wolf
Plant associations: Cactus, Benzoin, Lotus, White Poppy
Egyptian Creator scarab beetle associated with the dawn sun. From him rises the Sky Goddess Nut.
Khenmu—Male—Africa
(Also known as Khnum, Khnemu)
Wife: Haket
Animal association: Sheep
Early Egyptian, possibly Nubian, creator of humanity. Called the ’Great Potter,’ it is sometimes said that he created humanity on his potter’s wheel.
Khentyamentiu—Male—Africa
Animal association: Wolf
Egyptian god form who was once the personification and representation of the spirit of all previous kings. His lore was later absorbed by Osiris.
Khons—Male—Africa
(Also known as Chons, Khonsu, Khons, Khensu)
Father: Amun
Mother: Mut
Animal associations: Baboon, Hawk
Egyptian moon god who is called the ’Master of time,’ probably a reference to a lunar calendar.
Kikazaru—Male—Far East
’Hear no evil’—There is a 17th century temple in Japan which has a statue of three monkeys. The best translation of the inscription on that statue is ’See no evil, hear no evil, and speak no evil’ or ’Mizaru, Kikazaru, Iwazaru.’ The statuary is most likely a representation of the three faces of a much earlier deity form, Vadjra.
King Arthur—Male—Central Europe Father: Uther Pendragon
Mother: Igraine
Wife: Weynhwyfar
Lover: Morgan le Fay
Plant association: Alder
Historic British-Celtic figure, Artorius, who was mythologized into a position in Celtic lore where he attains godlike status. Often overlooked by modern Pagans due to the fic-tionalization of his story, it is clear that Arthur warns of the perils one brings to the workplace when matters of interpersonal relationships fail. May also be seen as a warning about incest. Clearly we see the warning that what begins as a small indiscretion can grow to haunt us.
Kishar—Female—Middle East/Mediterranean
Father: Lakhamu
Mother: Lakhmu
Husband: Ansar
Mother of Anu and Ea.
Kitche Manitou—Male—North America
In popular reference, he is the Muskwari demon who destroyed the known world once by fire and once by flood. It is likely the destruction of the known world was by volcano. This is probably not a cite to the Great Flood that allowed migration from the Middle East into Europe, as the timing is not consistent with humanity’s presence in North America.
Koevasi—Female—Melanesia
Animal association: Snake
Melanesian snake goddess associated with healing and the arts.
Kokyangwuti—Female—North America
Animal association: Spider
Hopi spider goddess who created all living things, humanity last. Upon realizing the world was filled with evil, she hid the good folk in underground caverns and then destroyed all that lived on the surface. Two more times, the surface of the world had to be destroyed while the good spirited folk hid from the destruction until finally she returned the good spirited folk to the surface, created Tuwaqachi which she filled with rich soil, and then settled those good folk there...in Arizona. Interesting enough, the state motto of Arizona is Ditat Deus, which means ’God Enriches.’
Komoku—Male—Far East
Japanese god who guarded the South, subordinate to Taishaku-ten. In Wiccan ritual he is sometimes connected with the South Quarter. The other three were Zocho, Bishamon, and Jikoku.
Koodjanuk—Male—Arctic North America
Eskimo god who is prayed to for health and healing.
Krishna—Male—Near East
Father: Vaseduva
Mother: Devaki
Lover: Radha
Animal associations: Bee, Elephant, Lion, Snake (cobra)
Plant associations: Acacia, Bay, Frankincense, Vine (grape)
Hindu god and twin brother of Balarama, eighth avatar of Vishnu, and boyhood friend of Arjuna. Krishna is one of the most popular of the Hindu deities in India. In the United States, he is Supreme God of the Hare Krishna.
Incense Recipe
4 part Frankincense
2 part Acacia flowers
1 part Bay leaf
A few raisins
Kuan Yin—Male—Central Asia
(Also known as Chenresi (Tibet), Guan Yin, Kuan-shi-yin)
Animal associations: Horse (white), Fish
Plant association: Lily
Recently, interest in the Chinese goddess Kuan Yin has become very popular. Interesting enough, very few seem to have noticed that she was initially male, not female. He was initially depicted as definitively male, a god whom women who wanted children but who had failed in many attempts would seek. Gradually, he became a god of compassion. In that transition, his appearance became softer and more rounded. Yes, there have been references and depictions of the Chinese Kuan Yin as female for many years, but to print modern literature without even the mention that she was once seen as male is an insult. It is in as much as to say that compassion is not an attribute that can be held by men. Now, wouldn’t one think that in the natural order of things, a woman who wants a child would do much better to turn to a male for assistance? I thus list him here as male.
Kubera—Male—Near East
(Also known as Dhanapati, Kuvera)
Hindu god of prosperity and wealth. One of the eight guardians of the principle directions. Kubera is the guardian of the North. The other seven are Indra, Agni, Yama, Surya, Varuna, Vayu, Soma.
Kul—Male/Female—North Europe (Also known as Kul-Jungk)
Animal association: Fish
Siberian water sprite, male and female, who jealously guard fresh water ponds and lakes. They are typically the ill-fate of humans who approach on them. Perhaps an explanation of the dangers of water in cold weather.
Kul-Jungk—See Kul
Kulkulcan—Male—Central America
Animal association: Snake (serpent)
Mayan feathered serpent god whose lore was absorbed by Quetzalcoatl.
Kurkil—Male—Central Asia
Mongolian Creator god who instructed humanity in the art of building community.
Kurma—Male—Near East
Animal associations: Elephant, Tortoise
Plant associations: Banyon, Damiana, Mandrake
Hindu second avatar of Vishnu who went to the bottom of the sea to recover things lost during the Great Flood. Patron of treasure hunters in all capacities.
KuzunoHa—Female—Far East
(Also known as She-Fox of Shinoda)
Animal association: Fox
Japanese fox who so fell in love with the man who saved her life that she gave up her natural form, assumed the form of a human, and married him.
Kwannon—Female—Far East
Animal associations: Fish, Horse (white)
Japanese variant of the Chinese Kuan Yin.
Lada—Female—Central Europe/Northern Europe
Plant association: Lime tree
Slavic goddess of Beauty.
Lahar—Male—Middle East/Mediterranean
Animal association: Sheep (ram)
Sumerian god of all domestic farm animals, but particularly sheep. May have also been a Babylonian goddess with the same associations, but those cites are sketchy at best.
Lakini—Female—Near East
Hindu goddess associated with the Manipura chakra (solar plexus). Sometimes described as an aspect of Shakti. See also Dakini, Rakini, Kakini, Sakini, and Hakini.
Lakshmi—Female—Near East
(Also known as Shri, Sri)
Husband: Vishnu
Animal association: Peacock
Hindu goddess of luck, prosperity, and good fortune.
Lamashtu—See Lamia
Lamastu—See Lamia
Lamia—Male/Female—Mediterranean/ Middle East
(Also known as Lamashtu, Lamastu)
Animal associations: Donkey, Snake
A Libyan Queen who fell in love with Zeus and bore him several children. In outrage, Hera killed each of her children. In grief, Lamia became a bisexual snake deity who, knowing the grief that love and sex had brought her, would never again need a man to conceive children. From her story we see explained the horrible cycle of abuse that causes an abused child to become an abusive parent. So horrific was the death of her children at the hands of Hera and her jealous rage that Lamia quickly became jealous of all who have children and is sometimes said to gobble them up at every chance.
Lares—Male/Female—Mediterranean
(Also known as Lases)
Animal association: Dog
Generally speaking, Roman term to describe ancestral spirits who remained in the home to protect it and its inhabitants. They bring blessings to the home and to any farm land connected with the home. See Lemures, their unpleasant counterparts. When used in the more specific, the Lares were guardians of specific locations or places.
Lares Compitales: protect crossroads (decisionmaking)
Lares Domestici: protect the home
Lares Familiares: protect the family
Lares Permarini: protect the oceans and sea travels
Lares Praestitis: protect formal community (government)
Lares Rurales: protect open land
Lares Viales: protect travelers
Lemures—Male/Female—Mediterranean (Also known as Larvae)
Roman term to describe ancestral spirits who remained in the home and taunted its inhabitants. To appease them (or maybe drive them away), the master of the home led the ’Feast of the Lemures.’ During the event, they would either be appeased with offerings of food (black beans are cited often) or driven off with loud noise. See also Lares (their friendly counterparts).
La Sirene—See Erzulie
Latona—Female—Mediterranean
Roman name for the Greek Leto.
Laufey—Female—North Europe Husband: Farbauti
Scandinavian giant and mother of Loki.
Leda—Female—Mediterranean
Husband: Tyndareus
Lover: Zeus
Leda was married to Tyndareus, King of Sparta. To him she bore Tyndareus and Clytemnestra. While still married to Tyndareus, she was seduced/tricked by Zeus into his embrace where she conceived Pollux and Helen. As part of Zeus’ seduction involved taking the form of a swan and the result of that seduction was the Trojan War, we see a clear warning that deception and magick should not be involved in matters of love. Because Tyndareus and Leda were apparently monogamous, we also see a warning against disturbing monogamous relationships.
Leib-Olmai—Male—Central and Northern Europe
Animal association: Bear
Finnish personification of Nature’s strength as a bear god.
Leshi—Gods/Goddesses—Central Europe/ Northern Europe
Animal association: Goat
Russian woodland creatures, both male and female, whose antics are similar to Pan’s.
Leto—Female—Mediterranean
Father: Coeus
Mother: Phoebe
Lover: Zeus
’Hidden one’—When Leto became pregnant with Artemis and Apollo by Zeus, Hera forbade her from giving birth on land or any island. The children grew in her womb until it was incredibly painful. To circumvent Hera and finally give birth, she went to a floating island of which Hera did not say she could not. The Romans called her Latona.
Leucippe—Female—Mediterranean
Husband: Evenor
Lover: Poseidon
Animal association: Horse (white mare)
Greek nymph who accompanied Persephone into the Underworld. Although she is married to Evenor, Poseidon fell in love with her. Together, she and Zeus had five pairs of male twins to whom Zeus gave Atlantis.
Liber Pater—Male—Mediterranean
Plant associations: Almond, Vine (grape)
Roman god of wine and fertility. His female counterpart is the goddess Libertas. He is closely associated with Dionysus.
Libertas—Female—Mediterranean/North America
(Also known as Liberty)
Animal association: Cat
Roman goddess who was later adopted by North America as the personification of the United States. Her male counterpart, Liber Pater Libertas, is goddess of Freedom, both personal and national.
Lilith—Female—Middle East
Husband: Adam
Animal association: Owl, Snake (serpent)
’She of the night’—The first wife of Adam, later replaced with Eve. She and Adam were created as conjoined twins. But Lilith demanded more autonomy, so they were separated. From there, much like the story of Diana and Lucifer, she pursued Adam for reunion (sex), but Adam would have nothing of it. Some cite her banishment and transformation into the serpent that tempted Eve, Adam’s second wife. Others feel Lilith became an aspect of Eve in the way the pre-separation Diana must surely be an aspect of the Diana after separation. It is very interesting to note the meaning of her name and the association between Diana and Night/Darkness.
Lips—Male—Mediterranean
(Also known as Livos)
Greek personification of the South West Wind.
Lissa—Male—Africa
(Also known as Lisa, Leza)
Animal associations: Chameleon, Dog
Supreme God of Central Africa who instructed humanity on building community and culture. He does not listen to prayers much anymore because he has grown old and deaf.
Llew Llaw Gyffes—Male—North Europe/ Central Europe
(Also known as Lleu)
Wife: Blodeuwedd
’Bright lion with sure hand’—Welsh god who died at the hands of Gronw while fighting over his wife, who had been unfaithful to him with Gronw. Llew and Gronw died in that conflict, but Llew was magickly restored. Patron of those whose spouses have been unfaithful.
Llyr—Male—Central Europe
Wife: Iweridd
Son: Bran the Blessed by Iweridd
Welsh god of the sea and origin of Shakespeare’s character King Lear.
Loa, The—Male and Female—Caribbean
Caribbean Voodoo guardians of natural forces and of humanities negotiations with those forces. The loa are either ancestral spirits (protectors of the family line) or protectors of certain locations (personified natural forces) who are governed by Damballah. They are called by drawing an ’eve’ on the ground.
Lokapalas, The—Male—Near East
Hindu gods who are personification and guardians of the eight principle directions: Indra, Agni, Yama, Surya, Varuna, Vayu, Kubera, and Soma.
Loki—Male—North Europe (Also known as Look) Father: Farbauti
Mother: Laufey
Wife: Sign
Lover: Angurboda
Animal associations: Coyote, Horse, Jackal, Salmon, Wolf
Plant association: Benzoin
Scandinavian trickster god. He is one of the Aesir, but often finds himself at odds (and war) with them. He is also father, by Angurboda, of the three monstrous children of ill-fate; Fenrir, Hel, and Jormungand.
Long—Male—Central Asia (Also known as Lung) Animal association: Dragon
Chinese creature guardian of the North. He is described as a dragon. The other three guardians are Ch’i-lin, Gui Xian, and Feng-haang. They are collectively known as the Ssu Ling.
Lono—Male—Polynesian Islands Plant association: Kava Kava
Hawaiian god of song and fertility who fell in love with the mortal Kaikilani. They were wed and lived happily ever after in monogamous bliss where each filled the other’s needs and desires. Well, happily ever after until Lono mistakenly thought Kaikilani had been unfaithful, at which point Lono killed his beloved wife. Realizing his loss, he left the island promising to return when he had recovered from heartache and overcome rage. He has not yet returned. His story speaks much to those of us who suffer from anger management problems. Patron of those who battle jealousy and anger management issues.
Lucifer—Male—Mediterranean/Middle East
Roman god who is all but overlooked by modern-day Wiccans because of the Christian connection to Satan. Others overlook him due to his reportedly incestuous relationship with his sister Diana. You see, Diana and Lucifer were not brother and sister at all; to be such, one would have to be born of mother and father. They were not. Their story is that which is presented in the Book of Genesis. The name Diana is used to describe that which was both Darkness (Diana) and Lucifer (Light) prior to the separation of Light and Darkness. After separating into Diana (Darkness) and Light (Lucifer), Diana, having known what it was like to be truly alone, sought instantly to unite with Lucifer. Lucifer, not having known what it is like to be truly alone, resisted her advances. Eventually, the two did become lovers when Diana shape-shifted into a cat and tricked her way into his bed. The use of his name is one of the Inner Court secrets of many Wiccan traditions. However, in hiding the use of this story, we lose much on which Wicca has been built. After all, what would the Charge of the God-dess—a text considered sacred—be without the words of Aradia (daughter of Lucifer and Diana) found in Aradia: Gospel of the Witches?
Ludd—Male—Central Europe (Also known as Nuada)
Animal associations: Dog, Fish, and all sea creatures
’Silver Hand’—Celtic river god who lost his hand in combat. His brother created a silver hand to replace it. He is sometimes seen as Sun God and protector of children, but with his invincible and indestructible magick sword, he is more often associated with war, combat, and the ability to overcome great odds by using magick.
Lugh—Male—Central Europe See also Llew Llaw Gyffes Father: Cain
Mother: Eithne, Tailtiu (adopted) Lover: Dechtire
Animal associations: Raven, Deer (white stag), Dog
Plant associations: Alder, Blackberry, Gorse, Holly
Holiday: Lughnasadh (the Gaelic word for August)
Irish god who excelled at many skills. Sometimes known as ’Lugh of many arts’ or ’Lugh of the long hand,’ he was said to be particularly skilled with precision and attention to detail. In a modern world, Lugh can be seen as patron of such matters as computer repair or automotive maintenance. But in an older time, we was seen as man about the home, able to repair or build just about anything.
Luna—Female—Mediterranean
Plant association: Willow
’Moon’—Roman personification and Goddess of the Moon. She was later absorbed or identified with Diana and Hecate.
Lupa—Female—Mediterranean
Animal association: Wolf
Potentially the name given to the promiscuous aspect of Acca Larentia.
Lu-xing—Male—Central Asia (Also known as Lu-Hsing) Animal association: Deer
Chinese god of status and wealth.
Maat—Female—Africa
Animal associations: Ostrich, Lynx
Egyptian goddess of truth and divine justice in the natural order of things. It is her symbol, the feather of Maat, that a person’s soul is weighed against in the afterlife to determine the eventuality of the soul.
Macha—Female—Central Europe
Father: Delbaeth
Mother: Ernmas
Animal associations: Crow, Raven
Irish goddess of war and one of the Irish Triple Goddesses of Fate. The other two are Badb and Anu. See also Morrigan.
Mafdet—Female—Africa
Animal associations: Cat, Mongoose
Very early Egyptian goddess form. She was invoked to protect against snakes and scorpions and for the healing of snake bites and scorpion stings.
Mah—Male—Middle East
Animal associations: Cattle (Cow)
Holiday: The seventh day after each new moon
Persian moon god who presides over time and the tides.
Maia—Female—Mediterranean
Father: Atlas
Mother: Aethra or Pleione
Lover: Zeus
Greek goddess whose sacred month is May. She is the eldest and most beautiful of the Pleiades.
Mait Carrefour—Male—Caribbean
(Also known as Maitre Carrefour, Kalfu)
Haitian Voodoo ’Lord of the Crossroads’ and master of magick.
Maman Brigidt—Female—Caribbean
Haitian Voodoo goddess of death, resurrection, and the erotic associations made with both. Her male counterpart is Ghede.
Mama Occelo—Female—Inca
Husband: Manco Capac
Inca goddess. For her story, see Manco Capac.
Manannan Mac Lir—Male—Central Europe Wife: Fand
Animal associations: Boar, Crane, Horse, Gull, Cow
’Manannan Son of the Sea’—Irish god of the sea who could forecast the weather.
Manco Capac—Male—South America
Wife: Mama Occelo
Inca fire and solar god who founded the first Inca city and capital Cisco and began the empire of the Inca. He and his wife taught community building to humanity while his brother, Pachacamac, created the world, humanity, and all things.
Mani—Male—Northern Europe
Father: Mundilfari
Mother: Glaur
Scandinavian personification and God of the moon. His sister is Sol, the Sun.
Mania—Female—Mediterranean
Husband: Mantus
Roman/Etruscan goddess of death and Greek personification of insanity.
Mantus—Male—Mediterranean
Wife: Mania
Roman/Etruscan god of the Underworld.
Maou—Male—Africa
Father: Lissa
West African sun god.
Maponos—Male—Central Europe
(Also known as Mabon)
Animal associations: Horse, Dog (hound)
Holiday: Autumn Equinox (AKA Mabon)
’Divine son’—Celtic god of youth and youthful endeavors. He is patron and protector of children, folk hero, and great hunter.
Marduk—Male—Mediterranean
Father: Ea
Mother: Damkina
Wife: Zarpanitu
Lover: Ishtar
Animal associations: Eagle, Dragon (snake), Lion, Antelope
Babylonian god who became Supreme God of the Babylonian pantheon. Initially he was a god of thunderstorms and the fertility that the rain brings to the Earth.
Mari—Female—Mediterranean
Animal association: Owl
’Queen’—Queen/Supreme Goddess of the Basque pantheon. She is the personification of Earth and storm, especially in the association with death by natural forces. When the old religions were replaced with Christianity, she became Santa Marina.
Marian—Female—Central Europe
Plant association: Myrrh, Myrtle
Holiday: Bealtaine
The Sea Goddess Marian is a potential origin for both the stories of the mermaid as well as Robin Hood’s Maid Marian. Now, before one jumps to the conclusion that she is not a legitimate goddess form, let me point out that the difference between mythology and lore is often nothing more than the age of the story. In more contemporary culture she is Queen of the May.
Marici—Female—Near East
Animal association: Boar (sow)
Hindu goddess of dawn who travels in front of the sun. For this reason she is said to be invisible. Also seen as controlling the fate of reincarnation based on a soul’s karma from past lives.
Mars—Male—Mediterranean
Wife: Bellona
Lover: Rhea Silvia
Animal associations: Vulture, Woodpecker, Horse, Wolf, Boar, Sheep
Plant associations: Aloe, Ash, Benzoin, Buttercup, Coconut, Dogwood, Dragon’s Blood, Geranium, Myrrh (sweet/opoponax), Nettle (greater), Oak, Olive, Pepper (black), Rue, Vervain, Wormwood
Roman god of war. His wife, Bellona, is sometimes cited as his sister. The months February and October are sacred to him as is March, which was named after him. On the Quinquatrus, the weapons of war were cleaned in connection with his festival. Although most often called the god of war, he is often depicted named and in the embrace or partial embrace of a beautiful woman (who is not always described as his wife). He was initially associated with fertility, Spring, crops, and livestock. He most likely became a god of war as crops and live stock were threatened.
Incense Recipe
(for offensive and projective defense)
1 part Dragon’s Blood resin
1 part Benzoin
1 part Vervain
1 pinch Wormwood
Enough Mars (from the second Recipe) or Opoponax oil to bind
Mars Oil Recipe (for protection and fertility)
9 drops Opoponax (sweet myrrh) essential oil 6 drops Benzoin essential oil
3 drops Black Pepper essential oil
1/2 ounce Olive oil
Mars Oil Recipe
(for offensive and projective defense)
9 drops Dragons Blood perfume oil
6 drops Black Pepper essential oil
6 drops Benzoin essential oil
1/2 ounce Olive oil
Mary Cleopas—Female—Middle East/Medi-terranean
Half-sister of the Christian mother of Jesus. Sometimes said to form a Triple Goddess with the Virgin Mary and Mary Magdalene; however, the Virgin Mary had two half-sisters. The other is Mary Salome, so the names of the Christian Triple Goddess sometimes vary.
Mary Magdalene—Female—Middle East/ Mediterranean
Husband: Jesus
Sometimes said to form a Triple Goddess with the Virgin Mary and Mary Cleopas. However, as the Virgin Mary had two sisters by the name Mary, some feel citing those three is a better reference to a Christian Triple Goddess. In addition to the Virgin Mary, the other two are Mary Cleopas and Mary Salome (as opposed to Mary Magdalene). Additional lore seems to indicate that Mary Magdalene is Mary Salome. That the name change was made to protect the blood-line of Jesus.
Mary Salome—See Mary Magdalene
Mashia—Male—Middle East/Mediterranean
Father: Gayomart
Wife: Mashiane
Persian first man who, like the Christian Adam, was led away from god (Ormazd) by the evil adversary of god (Ahriman).
Mashiane—Female—Middle East/Mediterra-nean
Father: Gayomart
Husband: Mashia
Persian first woman.
Maslum—Male—North America
Algonquin antagonist of his brother, Glooskap. Maslum is credited with the creation of all things that are baneful to humanity.
Massim Biambe—Neutral—Africa
Creator god of the Congo who was neither male, nor female, nor hermaphrodite. Supreme God who created humanity with Phebele and Mebeli. Phebele and Mebeli gave birth to a son, thus giving humanity form (body), but it was not until Massim gave that body the breath of life (soul) and mind that humanity was truly born.
Matarisvan—Male—Near East
Hindu messenger of the gods who captured lightning and gave it to humanity in the form of fire.
Matowelia—Male—North America
God of the Mojave tribe who guided and protected tribe members in their travels. It was widely believed that to be with him after death, one’s body must be cremated. Sacrificing a meal or the value of that meal to one in need just prior to traveling was said to bring his blessings on a journey.
Matsya—Male—Near East
Animal associations: Dolphin, Fish
Plant association: White Poppy
Hindu first avatar of Vishnu. Prior to the Great Flood, a mortal named Manu discovered a small fish that asked for his protection. That man granted the fish his protection and allowed no harm to come to it, even though the man was very hungry. In return, the fish warned Manu of the flood that was approaching. Eventually the fish grew to a great size, and the man recognized it as an incarnation of Vishnu. After the Great Flood, Matsya (incarnation of Vishnu) assisted Manu in reseeding the Earth.
Matuta—Female—Mediterranean
(Also known as Mater Matuta)
Roman personification of Dawn and goddess of growth. She is patron and protector of newborn babies.
Maui—Male—Polynesian Islands Plant association: Banyan
Polynesian/Hawaiian sun god.
Mayauel—Female—Central America
Animal associations: Snake, Tortoise
Aztec goddess who, with Quetzalcoatl, brought love to humanity. Interestingly enough, she also brought all intoxicants.
Mebeli—Female—Africa
Husband: Phebele
Congo creator of the first of humanity. See Massim Biambe.
Medha—Female—Near East
Husband: Dharma
’Understanding’—Hindu goddess of empathy and compassion.
Meditrina—Female—Mediterranean
’Healer’—Roman goddess of wine and health. Perhaps an early observation of the connection between moderate alcohol use and health benefits.
Medusa—Female—Mediterranean
Animal associations: Snake, Horse (Pegasus), Moth
Ruler of the Gorgon. She is so hideous that any man who looks upon her gaze becomes stone. One story on how this happened says that Medusa was initially very beautiful—so beautiful that Poseidon welcomed her to his godly embrace. The jealous Athena would have none of it, so she turned Medusa’s hair to snakes.
Megaera—Female—Mediterranean
’Jealous One’—Greek goddess of justice and vengeance. One of the three Erinyes (Furies) with Alecto and Tisiphone.
Mehilainen—Female—Northern Europe Animal association: Bee
Finish sacred messengers manifest in the bee. May be connected to Mellonia (who taught bee-keeping), or may just be a word for bee.
Meilikki—Female—North Europe Animal association: Bear
Finish goddess of the green. Sometimes depicted as a female incarnation of the Green Man.
Melanion—Male—Mediterranean
Wife: Atalanta
Greek god who fell in love with Atalanta. His advances were originally rejected by Atalanta who said that he could not have her hand unless he first beat her at sport. So he and she had a foot race in which Melanion dropped three golden apples given to him by Aphrodite. Melanion won the race and her hand because Atalanta stopped to pick up the apples. In so doing he set the stage for the later observation that ’All is fair in love and war.’ Patron of suitors of women playing hard to get.
Melkart—Male—Middle East/Mediterranean
Animal association: Quail
Phoenician folk hero, god, and patron of city dwellers and dwellings. Some cite as a Phoenician equivalent of Hercules.
Mellonia—Female—Mediterranean
(Also known as Mellisa)
Animal association: Bee
Perhaps an aspect of Demeter, Mellonia is a fertility goddess. She is said to have taught humanity the art of bee-keeping.
Melpomene—Female—Mediterranean
’Choir’—Greek Muse of the tragedy. See also Muses, The.
Menat—Female—Middle East
(Also known as Manat)
Father: Allah
Holiday: Dark Moon
An aspect of the Triple Goddess Allat. She is goddess of time and fate. Her holiday is the dark moon, but the whole of the waning moon cycle is also sacred to her. See also Allat.
Menthu—Male—Africa
Animal associations: Falcon, Bull
Egyptian god of war who is often depicted as having the head of a falcon or hawk.
Mercury—Male—Mediterranean
(Also known as Mercurius, Alipes)
Lover: Venus
Animal associations: Ape, Jackal, Snake, Swallow, Turtle, Tortoise
Plant associations: Almond, Beech, Broom, Cinnamon, Hazelnut, Lavender, Lemongrass, Lotus, Mulberry, Olive, Palm (date), Vervain, Willow
Roman god of communication, travel, and merchants. He is the father of Cupid by Venus; as messenger of the gods this is perhaps commentary on the relationship between love and good communication. The month of June was sacred to Mercury. At one time the worship of this Roman god was so far reaching that the Celts and Norse also joined in his praise.
Incense Recipe
2 parts Lavender flowers
· 1 part Lemon Grass
· 1 part Gum Arabic
Enough Mercury or Lavender essential oil to bind
Oil Recipe
· 11 drops Lavender essential oil
9 drops Lemongrass essential oil
1/2 ounce almond or olive oil
Merope—Female—Mediterranean
(Also known as Aero)
Husband: Sisyphus
Greek virgin and one of the seven Pleiades. Her hand was wildly pursued by Orion (and the other Pleiades), but she did not love them. Even when her suitors’ powerful mothers became insistent that she take the hand of a god, she refused and instead chose Sisyphus, a mortal, because he had won her heart.
Meshkent—Female—Africa
(Also known as Mesenet, Meskhenet, Meskhent)
Husband: Shai
Egyptian goddess of childbirth and the personification of the birthing place. As she is responsible for shaping the child in the mother’s womb and giving to that child its ’ka’ (life force), she is goddess of initial fate.
Meztli—Male—Central America
Animal association: Butterfly
Aztec word for both moon and month used in the Meztlian religion and calendar. He became chief god of the Meztlian religion at its inception. A priest of the sun worshipping religion, Teotlahtolli, had instructed his son never to look directly at the sun. He ignored his father’s wishes and went blind. Taking his son to a priest of the sun, he asked him why their god would strike blind his son only for adoring the sun’s brilliance. The priest told the father it happened because the child was insolent in trying to see, and thus know, the face of God. So outraged was the father that their god would blind his son for such a natural curiosity that he left the Teotlahtolli religion and formed his own, the Meztlian who worshipped a loving god—the Moon or Meztli.
Miach—Male—Central Europe
Father: Dianchecht
Irish god who, like his father, was known as a great healer. Unfortunately, he is also a rather jealous god, having occasion to destroy the superior work of others.
Michabo—Male—North America
Wife: Muskrat
Animal association: Hare
Sometimes appears as an Algonquin folk hero, similar to Mungan Ngana of Australia, who invented a system by which one can write music, make fish nets, boats, advanced tools and weapons, as well as a host of other devices that greatly improved the lives of his people. Other times he appears as the Algonquin Creator, a great hare.
Michael—Male—Middle East/Mediterranean (Also known as Mika’il [Arabic])
Semitic God of Fire. He is also one of the only two angels mentioned by name in the modern Christian Bible. The other being Gabriel. Gnostic archangel who is associated with the South Quarter in Wiccan, Gnostic, and Ceremonial rituals. The other Quarters are presided upon by Raphael, Gabriel, and Auriel.
Mictancihautl—See Mictlantecuhtli
Mictlantecuhtli—Male—Central America
Wife: Mictlancihautl
Animal associations: Bat, Owl, Raven, Spider
God and ruler (with his wife) of the lowest level of the Aztec Underworld, Mictlan.
Mimir—Male—North Europe
Plant association: Yew
Scandinavian god of fresh water, especially streams, who grants the gift of wisdom and divination but insists a price be paid such that his gifts be honored. He is associated with the Yggdrasil, the world tree most often said to be ash, but which a growing number of folk, including myself, cite as yew. Patron of poets and those seeking wisdom. Yggdrasil is also called the Tree of Life. The story of Mimir and Odin is that Mimir was the guardian of the Yggdrasil who commonly drank from the streams (Mimir’s Well). Odin asked Mimir for a drink, but Mimir wanted his eye in exchange. Upon giving him his eye, Odin drank deeply and received the same gifts of wisdom and divination. This is probably a reference to the shamanic practice of using chemically achieved altered states as reportedly the vapors (streams) that rise from the roots of the yew will induce intoxication and visions.
Min—Male—Africa
(Also known as Menu, Minu)
Animal associations: Bee, Bull (white), Lion Plant associations: Lettuce, Wheat
Egyptian god of sexual potency. He was always depicted with an erect penis. He was also the protector of travelers, especially those who traveled across the desert. Patron of the travelers and sexual potency. As ’Menu’, sometimes cited as a Lithuanian moon god.
Minerva—Female—Mediterranean
Husband: Jupiter
Animal associations: Owl, Horse, Cattle (ox), Sheep (ram), Snake
Plant associations: Dragon’s Blood, Geranium, Olive, Lily (tiger), Mulberry, Thistle
Roman goddess of both education and war. Patron of commerce, entertainers, and minstrels. She was the inventor of the alphabet of mathematics (numbers) and is thus associated with the science of the written language, although not with words themselves. She is also said to have invented either musical instruments or the method by which the sounds of those instruments can be recorded in a written form (sheet music).
Minos—Male—Mediterranean
Wife: Pasiphae
Animal associations: Cattle (bull), Elephant
Plant associations: Aloe, Myrrh, Olive
Greek king who called on Poseidon in a dispute over land and its rule, he later became the judge of the Underworld. He decides who would move on to Elysian Fields (Heaven) and who would go to Tartarus (Hell).
Incense Recipe
Yellow Sandalwood powder with enough Galbanum oil to bind
Oil Recipe
21 drops Galbanum oil
1/2 ounce Olive oil
Minth—Female—Mediterranean
Lover: Hades
Plant association: Mint
Greek nymph who slept with Hades, thus bringing on the wrath of Persephone, who flattened her into the Earth with such force that the only thing that remained was the plant that we now call mint.
Misharu—Male—Middle East/Mediterranean
Babylonian god of law who brings order to civilization.
Mithras—Male—Middle East/Mediterranean/ Near East
(Also known as Mitra [Hindu])
Animal associations: Eagle, Cattle (bull), Chicken (cock), Hawk, Raven, Lion, Dog, Horse, Snake, Dragon
Plant associations: Cypress, Violet
In the Near East, he is a lesser sun god called Mitra. There his worship was not abundant. But in Persia, we see a different story. There he is god of morality, friendship, and truth. He developed into a war god who granted victory to the just when found to be in conflict with the unjust. Eventually his worship found its way to Rome where he is Mithras. Animal sacrifice was paid to him, most often in the form of a bull. Those sacrifices were thought to assure fertility to the land. This reinforces the Wiccan belief that for life there must be death. See Mitra for the attributes specific to the Near East.
Mitra—Male—Near East
(Also known as Mithras)
Father: Kashyapa
Mother: Aditi
Mitra is one of the Adityas. The Hindu month Agrahayana (November 22-December 21) is sacred to Mitra. See Adityas. See also Mithras for the evolution of this deity from Near East into Rome.
Mixcoatl—Male—Central America
Mother: Cihuatcoatl
Aztec god of hunting and war who brought the secret of fire to his people.
Mizaru—Male—Far East
Animal association: Monkey
’See no evil’—There is a 17th century temple in Japan which has a statue of three monkeys. The best translation of the inscription on that statue is ’See no evil, hear no evil, and speak no evil’ or ’Mizaru, Kikazaru, Iwazaru.’ The statuary is most likely a representation of the three faces of a much earlier deity form, Vadjra.
Mobo—Female—Central Asia/Far East
Chinese/Japanese personification of the perfect mother.
Modron—Female—Central Europe
Welsh Great Mother who may have been the historic figure ’Morgain la Fee,’ who was included in the mythology of King Arthur. That is to say, Modron likely existed as a flesh and blood woman, as did King Arthur, but with the creation of lore they both became mythologized.
Moingfhion—Female—Central Europe
Holiday: Samhain
Irish Crone/grandmother goddess associated with Samhain.
Moko—Male—Polynesian Islands
Animal association: Lizard
Polynesian magician, god, and teacher of magick. He is seen as a large lizard.
Mo Li, The—Male—Central Asia
The four guardians of Chinese Buddhism. See Shou, Hung, Chung, and Hai.
Monan—Male—South America
Brazilian Creator god to the Tupis and other people along the Amazon Valley.
Montu—Male—Africa
Father: Amun Ra (adopted)
Mother: Mut (adopted)
Animal associations: Cattle (bull), Falcon, Hawk, Sheep (ram), Owl, Horse, Bear, Wolf Plant associations: Dragon’s Blood, Lily (tiger), Geranium, Pepper (black), Rue, Wormwood
Initially a minor sun god of the southmost areas of Egypt. As war became more a part of Egyptian life, he evolved into a war god of greater importance. Soon, his worship spread to much of Egypt.
Incense Recipe
4 parts Dragon’s Blood
1 part Wormwood
1 pinch black pepper
Morgan le Fay—Female—Central Europe (Also known as Morgain la Fee)
Father: The Duke of Cornwall
Mother: Igraine
Lover: King Arthur, Myrddin
Half-sister of King Arthur. In some stories, she bore to King Arthur his only son, Mordred. In other stories, Mordred was Arthur’s cousin. In some stories, she is Merlin’s (Myrddin) lover and plotted to destroy the reign of Arthur by causing his wife’s infidelity. As the story cannot be proven to be historic, no one can be sure what the events really were. I think that as Arthur was conceived using manipulative love magick, his downfall came from the manipulative love magick used to create Mordred. Thinking that way reminds us that those who do not remember history are condemned to repeat it.
Morpheus—Male—Mediterranean
Father: Thanatos
Plant association: Broom
’He who forms’—Greek god of dreams and their manifestation in the world of the living, who lived in the darkness of the Underworld. From his name and his attributes, we see that the Greeks saw a connection between the dream world and the manifestation of reality.
Morrigan, The—Female—Central Europe (Also known as Morrigu)
Father: Delbaeth
Mother: Ernmas
Animal associations: Crow, Raven
Plant association: Sloe (blackthorn)
Irish goddess of war and fate. In her role as goddess of fate, she is seen as a Triple Goddess of Fate and is the embodiment of her three daughters, Badb, Macha, and Anu.
Mu Gong—Male—Central Asia
(Also known as Mu Kung)
Chinese Taoist personification of the male principle of the soul, the yang. He is called the ’Royal Father of the East.’ He is god of immortality and presides over the east half of Paradise in the afterlife.
Mullissu—See Belitis
Mullo—Male—Central Europe
Animal association: Mule
Celtic god of mules and those who work with or drive mules.
Muluku—Male—Africa
Mozambican Creator god who became so frustrated with humanity’s unwillingness to support themselves and each other that he created monkeys. He then took the monkeys’ tails away, placed those tails on humanity, and told each to be the other, thus making monkeys of humanity and humanity of monkeys. Some might argue he missed a few. Patron of those who work with folk who act like monkeys and everyone who works retail.
Mungan Ngana—Male—Australia
Australian Aboriginal folk hero, similar to Michabo of Africa, who taught his people how to make fish nets, boats, advanced tools and weapons, as well as a host of other devices that greatly improved the lives of his people.
Mulac—Male—Central America
Father: Itzamna
Mother: Ixchel
One of the Bacabs, the four Mayan gods of the principle directions. Associated with the color white. In Wiccan ritual he is associated with the North Quarter. See also Cauac, Ix, and Kan.
Muses, The—Female—Mediterranean
Animal associations: Swan, Horse (Pegasus)
Greek goddesses of inspiration. Most often cited as daughters of Zeus and Mnesyne. Their number has varied with time, most commonly cited as nine: Clio, Euterpe, Thalia, Melpomene, Terpsichore, Erato, Polyhymnia, Urania, and their leader, Calliope.
Mut—Female—Africa
Husband: Amun Ra
Animal associations: Eagle, Vulture, Cow, Cat, Lioness
Plant associations: Aspen, Cypress, Frankincense, Myrrh, Poppy (white)
’Mother’—Egyptian Creator and Mother Goddess. She is said to make the soul strong and the body sound.
Incense Recipe
3 parts Frankincense
1 part Myrrh
1 part Poppy Flowers (white is best but red/ blue will do)
1 part Cypress
Oil Recipe
8 drops Frankincense oil
6 drops Myrrh oil
6 drops Cypress oil
1/2 ounce base oil
Mylitta—Female—Middle East/Mediterranean
Babylonian moon goddess associated with love, fertility, and childbirth. Her temples were served by sacred prostitutes who sacrificed their virginity to strangers in exchange for the receipt of teachings in the ways of love.
Myrddin—Male—Central Europe
(Also known as Merlin)
Sister: Gwendydd
Lover: Morgan le Fay, Vivienne (Nimue)
Celtic and Welsh bard, magician, and speaker of prophecy who was associated with the mythic, or perhaps mythologized, Merlin of the King Arthur story.
Nabu—Male—Mediterranean
Father: Marduk
Animal association: Dragon (serpent-headed)
Sumero-Babylonian god of the written language, the alphabet, record-keeping, and wisdom. He maintains the tablets of fate and is the patron of librarians and record keepers.
Nago—Male—Africa/Caribbean
(Also known as Nago Shango)
Haitian Voodoo loa and African Yoruba god of power, especially power derived from ancestors and lineage.
Nah-Hunte—Male—Mediterranean
Babylonian Sun God of law and order. Patron of police officers and those working in the criminal justice system.
Nahmauit—Female—Africa
Husband: Thoth
Egyptian goddess who opposed and removed evil.
Nala—Male—Near East
Father: Visvakarma
Animal association: Monkey
Hindu metalsmith who built a bridge across the ocean with the help of monkeys. Patron of working animals and their masters.
Namagiri—Female—Near East
Hindu goddess of divination, inspiration, education, and teaching.
Nanan Bouclou—Male—Africa/Caribbean
African Creator (maybe bisexual) of the gods from what is now eastern Senegal. Upon his migration to the Caribbean, he became a Haitian Voodoo deity of plant life and the natural medicines made from plants.
Nanaya—See Nanna
Nanna—Female—North Europe
Husband: Baldur
Son: Forseti by Baldur
Scandinavian goddess whose story has partly led to the Wiccan tradition of the third rite of handfasting. Upon the death of her husband Baldur, Nanna committed suicide by throwing herself on the funeral pyre. Her story helps us to understand the nature of the third handfasting as an act that unites a couple even after they have left this world. Although the Wiccan rite does not involve suicide, the intent remains the same.
Nannar—Male—Middle East/Mediterranean
Sumerian moon god is called ’Lord of Destiny.’
Nanshe—Female—Mediterranean/Middle East
Father: Ea
Mother: Kishar
Babylonian goddess of fertility, water, and childbirth. She is said to give her followers the ability to interpret dreams and perhaps divine the future from dreams.
Nantosuelta—Female—Central Europe/ Northern Europe
Animal association: Raven
’Winding river’—Gallic river and water goddess who is said to bless and protect the home. As her name implies, the association to protecting the home is probably found in the observation that her people often build settlements with the entrance facing a river such that the river offered an element of protection.
Narasinha—Male—Near East
(Also known as Narasingha)
Animal association: Lion
Plant associations: Frankincense, Sunflower
Hindu fourth avatar of Vishnu. He is depicted as part man and part lion.
Na Reau—Male—Polynesian Islands
Polynesian god who created the first man and woman. He told them not to procreate, but of course they didn’t listen. This could be a reflection of the Christian Adam and Eve theme. Many Christians seem to believe that the forbidden fruit that their Bible speaks of was an analogy to sex. The difference is that Na Reau forgave them. Patron of children who become parents before they are ready
Nasr—Male—Middle East
(Also known as Nesr)
Animal association: Vulture
Mentioned in the Koran (71:23) as an idol. His condemnation as a false god in the Koran is similar to the condemnation that Moses gave to similar deities. When we consider the great amount of death that has been brought about as a result of such statements, we begin to see that although religious leaders and prophets have every right to express their opinion, giving name to one Supreme God and demanding that other images and names be forsaken is the first step towards genocide.
Natigai—Male—Central Asia
Mongolian Earth god who, with his wife, were the patrons of humanity in its attempts to raise plants and animals. Patron of farmers of crop and animal.
Ndengei—Male—Polynesian Islands
Animal association: Snake (serpent)
Creator seen by the folk of Fiji.
Nebo—Male—Middle East/Mediterranean
Babylonian god of teaching and education. He and his wife Tashmit invented the written language. Also the name of the island on which the Hebrew prophet Moses died.
Nehalennia—Female—Central Europe/ Northern Europe
Animal association: Dog
Teutonic goddess of fertility and navigation at sea. She became associated with commerce in association with trade as linked to ocean navigation.
Neith—Female—Africa
Animal associations: Bee, Vulture, Snake (golden cobra), Spider
Egyptian goddess associated with the Element Fire and the protection of the god Duamutef. As her worship spread, she gradually became a war goddess.
Nekhebet—Female—Africa
Animal associations: Vulture, Snake (serpent), Lion
Protective goddess of southern Egypt.
Nemesis—Female—Mediterranean
(Also known as Rhamnusia)
Father: Erebus
Mother: Nyx
Animal association: Deer
Plant associations: Apple, Ash
Greek goddess of anger and fate. She brings great punishment to mortals who break with moral law, especially against those who do so for personal gain.
Nephthys —Female—Africa
(Also known as Neb-hut, Nebthet)
Lover: Osiris (or maybe Set)
Animal associations: Chicken (cock), Dog, Horse
Plant associations: Cypress, Lily, Myrrh, Nettle, Poppy (white)
’Friend of the Dead’—Egyptian goddess associated with the Element Earth and the protection of the god Hapi. As Nephthys she is as her name implies, friend of the dead, but she is also Neb-hut (Nebthet), which means ’Mistress of Home.’ In that capacity, she is protector of children and women during childbirth. Here we see again the connection between birth and death.
Incense Recipe
2 parts Gum Arabic
1 part Sandalwood
1 parts Myrrh
1 part Cypress
1 part Poppy
Neptune—Male—Mediterranean
Wife: Furrina, Salacia
Animal associations: Dolphin, Horse, Bull, Fish, Shark, Whale
Plant associations: Ash, Bladderwrack, Lotus*, Myrrh, Olive, Water Lily, Poppy (white), Seaweed (all)
* May have been connected to Lotus due to the folk name use of the term Water Lily.
Roman god of fresh water who gradually became associated with the sea through his wife Salacia and his association with the Greek Poseidon.
Nergal—Male—Middle East/Mediterranean Lover: Ereshkigal
Animal association: Lion
Sumero-Babylonian god of the Underworld who brings baneful things to humanity. He is responsible for sickness, blight, and war. With his lover Ereshkigal, we see a clear personification of many of the attributes Christianity have given to Satan. In that connection, we take note that Nergal is often described as the evil attribute of Shamash. This gives rise to an interesting thought: In Christian mythology, is not Satan an aspect of the Christian God?
Nereids—Female—Mediterranean
Animal associations: Dolphin, Fish, and to some degree all sea creatures
The 50 daughters of Nereus and Doris who live in the Mediterranean sea. Unlike the mermaids and mermen of lore, the Nereids are depicted fully human. Instead of having the tails of fish, they ride dolphin and other sea creatures for transportation.
Nereus—Male—Mediterranean
Father: Pontus
Mother: Gaia
Animal associations: Fish and other sea creatures
Greek ’Old Man of the Sea.’ Father of the Nereids.
Nerthus—Female/Male—Northern Europe (Also known as Hertha)
Animal association: Cow
Scandinavian deity sometimes described as a hermaphrodite, but most often cited as female. She is a goddess of prosperity and peace. Again we see the association between prosperity and war. When there is peace, there is prosperity.
Ngai—Male—Africa
’Rain’—Masai god of rain. Often cited as a Supreme sky god. He is the personification of the black rain cloud when he is in a good mood and a red rain cloud when he is in a bad mood.
Nganaoa—Male—Polynesian Islands Animal association: Whale
Polynesian folk hero who kills three horrible sea monsters (maybe whales), then guts the beasts to find both his mother and father inside, still alive.
Nicneven—Female—Central Europe Holiday: Samhain
Scottish goddess of Witches who is associated with Samhain.
Nidaba—Female—Middle East/Mediterranean
Animal association: Snake
Sumerian goddess of education, learning, and the written language.
Nike—Female—Mediterranean
Father: Pallas
Mother: Styx
Animal association: Lynx
Plant associations: Benzoin, Sandalwood (red), Rose
’Victory’—Greek personification and goddess of victory. Seen as the constant companion to Athena, she is said to be able to run and fly at speeds far in excess of human standards. Her name was probably chosen for the now famous shoe company for her talents at running, but years later we see that her attribute as goddess of victory may have lent itself to that company’s great success.
Incense Recipe
2 parts Benzoin
1 part Sandalwood (red)
1 part Rose (red or white)
Nikkal—Female—Middle East/Mediterranean
Husband: Yerah
Phoenician moon goddess and the goddess of wild crafted harvests. She is associated with the Sumerian Ningal, an Earth goddess. With that and her husband being a moon god, one thinks that perhaps her association with the moon is more from her husband’s role and her role might better be seen as Earth goddess who presides over the wild crafted harvest.
Nina—Female—Middle East/Mediterranean/ Central Europe
(Also known as Eviene, Nimue, Niviene, Viviane)
Animal association: Snake
Perhaps a Babylonian Water goddess as the origin of the story of the Lady of the Lake as it found its way into European lore and eventually into the story of King Arthur. Her name is more likely an early generic term for goddess (Lady or Queen).
Ningal—Female—Mediterranean/Middle East
Husband: Nanna or Sinn (Babylonian)
Animal association: Mongoose
’Lady of the Summer’ or ’Queen of Summer’— Sumerian Earth Goddess. She is associated with the Phoenician Nikkal.
Ningirsu—Male—Middle East/Mediterranean Animal associations: Goat, Lion
’Lord of Girsu’ or ’King of Girsu’—Sumero-Babylonian rain god who instructed humanity in the art of negotiating with nature. Specifically, he is god of irrigation and the knowledge of irrigation. As such, he is seen as a fertility god of crops. His name is a reference to the ancient city of Girsu.
Ninhursag—Female—Middle East/Mediter-ranean
Husband: Enki
Daughter: Ninsar by Enki
Animal associations: Cow (calf), Snake
’Lady of the Mountain’ or ’Queen of the Mountain’—Sumerian Earth Goddess associated mostly with mountains. See Enki for her story.
Ninkurra—Female—Middle East/Mediterra-nean
Father: Enki
Mother: Ninsar
Daughter: Uttu by Enki
Lover: Enki
Sumerian goddess whose father, lover, and grandfather was Enki. See Enki for their story.
Ninlil—Female—Mediterranean/Middle East (Also known as Belitis, Mullissu)
Husband: Enlil
Animal associations: Lion, Snake
’Lady of the Wind’ or ’Queen of the Wind’— Sumero-Babylonian grain goddess whose name probably comes from association with her husband, who is Lord of the Wind.
Ninsar—Female—Middle East/Mediterranean
Father: Enki
Mother: Ninhursag
Lover: Enki
Sumero-Babylonian goddess who was daughter and lover to Enki. See Enki for the story.
Ninurta—Male—Middle East/Mesopotamia Wife: Gula
Animal associations: Eagle, Lion, Dragon (lion)
’Lord of the Earth’ or ’King of the Earth’— Sumero-Babylonian rain god who taught humanity the art of negotiating with Nature, specifically in the use of the plough to raise soil for planting. He, like his cousin Ningirsu, is chiefly concerned with humanity’s ability to grow food and support itself.
Niu Wang—Male—Central Asia
Animal association: Cattle (ox)
Chinese guardian and patron of livestock, especially cattle.
Njord—Male—North Europe
Wife: Skadi
Animal associations: Fish and all sea creatures
Father of Freyr and Freya. He is lord of the sea and of the winds that push ships over it.
Noah—Male—Middle East/Mediterranean/ Central Europe
’Rest’—In Christian lore, he is found in the ninth generation after Adam and Eve. This is a crucial bit of information as it helps to place the story of Adam and Eve into the historical accounts of the Great Flood which allowed migration into Europe. Although attempts to defeat such placements often cite that Noah died at the ripe old age of 950, generations are determined not by death but by birth. Even if Noah had lived to be 950 years old, he (and Adam and Eve) would have created children much earlier. For the Irish lore which likely lent itself to the modern Christian story, please see Bith.
Nodens—Male—Central Europe
(Also known as Nodons)
Animal association: Dog
Celtic river god and protector of the home. He is sometimes associated with crop fertility.
Nohochacyum—Male—Central America
Mayan Creator god who is constantly at war with Nohochacyum in the way that the Christian god is in opposition to Satan.
Nootaikok—Male—Arctic America
Animal association: Seal
Eskimo spirit who dwells on icebergs. Protector of wildlife, especially seals.
Noncomala—Male—Central America/Carib-bean
Costa Rican Creator who sent a Great Flood to destroy humanity because it had become evil.
Norianahary—Male—Madagascar
Madagascan god who sent his son, Ataokoloinona, to Earth to help him decide if Earth should be populated. When his son did not return, he sent a search party hoping to find his son. When they did not return, he sent a second, a third, and more. On and on he sent folk to find his beloved son and continues to do so today. Those he sent became the progenitors of humanity.
Norns, The—Female—North Europe (Also known as The Three Wyrds, The Weird Sisters [Shakespeare])
Animal association: Spider
Holiday: New Year’s Eve
Teutonic Three Fates represented by Urd, Verdandi, and Skuld who were collectively known as Wyrd. See also Wyrd.
Notus—Male—Mediterranean
Father: Astraeus
Mother: Eos
Greek god of the South Wind associated with the South Quarter (Fire) in Wiccan ritual.
Nu-Kua—Female—Central Asia
Husband: Fu-Hsing
Animal association: Snake
Chinese Creator who made the first humans of yellow clay.
Nuah—Female—Middle East/Mediterranean
Babylonian moon goddess involved in the Great Flood. Because her tale was absorbed by Ishtar, she is often overlooked. This is unfortunate as her name show the clear connection between the Babylonian Great Flood and the one recorded in the Old Testament. The Old Testament Noah is likely a masculine version of the name Nuah, although in the Babylonian story she is the goddess whose actions began the Great Flood. See Ishtar.
Nurelli—Male—Australia
Australian god of law and order to the Wiimbaio tribe. Patron of those who work in criminal justice and politics.
Nusku—Male—Middle East/Mediterranean/ Central Asia
Sumerian god of fire and light. His sacred flame was said to destroy evil. Eventually he migrated into Western Asia. There he acquired an association with the building of civilization.
Nut—Female—Africa
(Also known as Nuit [Thelemic])
Father: Shu
Mother: Tefnut
Lover: Geb
Animal associations: Cow, Eagle, Peacock Plant associations: Amaranth, Coconut, Olive, Sycamore
Holidays: August 24-28, December 25.
Egyptian personification and Goddess of the Sky, the Heavens, and the Stars that burn there. She is the veil between chaos and order. She is depicted as a skyclad woman painted with the burning stars of heaven who is held to the sky by her father Shu. Her husband Geb is the Earth below her. The name Nuit is an alternative spelling made popular by Aleister Crowley. In Wiccan ritual she is associated with the South/Fire quarter. See also Ra, Tefnut, Shu, and Geb.
Nyame—Male—Africa
(Also known as Nyankopon)
Ashanti god of sky, storms, and lightning. Nyame is the supreme deity of his pantheon. Provided humanity with sun, moon, rain, and the other requirements of farming after requested by Anansi. As creator of humanity, his story is loosely the story of Adam, Lilith, and Eve, except here it was the first man that became rebellious and later described as evil. So Nyame buried him and created a second man to be the husband of the first woman, whom Nyame created from a tree. They went on to become the progenitors of humanity.
Nymphs—Female—Mediterranean Animal association: All wild animals
Greek Nature spirits most commonly represented as beautiful women clad only by the sky. The male counterparts are the Satyr.
Nyx—Female—Mediterranean
Lover: Erebus
’Night’—Chaos is sometimes cited as her father, brother or lover. See Chaos for an explanation. Nyx and Erebus are often cited as brother and sister because they share the same father. However, their birth did not involve the Great Rite. Instead, they were the son and daughter of Chaos in the way Darkness and Light were the children of the Nameless One of the Book of Genesis.
Oba—Female—Africa
Yoruba river goddess who tried to win the favor of Shango by offering him her ear to eat.
Ochun—Female—Africa/Caribbean
(Also known as Carida)
Plant associations: Adam and Eve Root, Apple (blossom), Apricot, Allspice, Almond, Anise, Basil, Catnip, Chamomile (common), Chickweed, Cinnamon, Clove, Copal, Coriander, Cumin, Calamus, Cedar, Dill, Dragon’s Blood, Deerstongue, Elder, Five Finger Grass, Frangipani, Galangal, Grains of Paradise, Ginger, Ginseng (American), Hyacinth (wild), Hibiscus, Hazel, Heather, Heliotrope, Honeysuckle, Hyssop, Irish Moss, Jasmine, Lemon Grass, Lavender, Lucky Hand Root, Marjoram, Meadowsweet, Myrtle, Nettle (greater), Nutmeg, Olive, Orange (sweet), Oakmoss, Orris, Patchouli, Parsley, Peppermint, Red Clover, Roses (yellow), Rosemary, Sesame, Saffron (Mexican), St. John’s Wort, Tonka, Vervain, Vanilla, Yarrow
Yoruba goddess who migrated into the Caribbean and became the Orisha of love, marriage, and motherhood. Similar to the goddess Venus. Her story illustrates how struggle and adversity are often times the price of a harmonious life. Early in her life, she owned only one dress and found it necessary to become a prostitute to feed her children. When the rest of the pantheon discovered this, they removed her children, feeling that a prostitute was not an appropriate role model. This caused her to become insane and wander about aimlessly. However, because she still had her pride she continued to wash her one dress every day to remove the soils that gathered there from her work as a prostitute. There, by the river where she always washed that dress, she was seen by the Orisha Aje-Shaluga who immediately fell in love with her. With his love, she regained not only her sanity but her children. Although this story is often rejected because it is seen as overly patriarchal, it is a wonderful example of how love triumphs adversity and support for the belief that two people are much better suited to face adversity than one.
Incense Recipe
2 parts Dragon’s Blood
2 parts Copal
1 part Jasmine
1 part Lavender
Oil Recipe
8 drops Patchouli oil
4 drops Cinnamon oil
4 drops Basil oil
4 drops Cedar oil
Уг ounce base oil (try a 50/50 mix of Almond and Sesame oil)
Odudua—Female—Africa/South America (Also known as Oduduwa, Odudu) Husband: Obatala
Brazilian Voodoo Earth Goddess who migrated from the Yoruba. She was created by Olorun on the island of Ife much as Adam and Lilith were created in Eden. But she, as some say was Lilith, was far more interested in sex and procreation, so she left Obatala in favor of many other lovers. She is sometimes described as male and her husband female in an effort to place the wander lust with the male half of the union. Patron of those who prefer polyamory.
Obask Nsi—See Ison
Obatala—Male—African/Caribbean/South America
(Also known as Orisanla)
Wife: Odudua
In Santeria, his name is Obatala
In Voodoo, his name is Batala/Blanc Dani
In Africa, his name is Obatala
Saint/Catholic associations: Our Lady of Mercy, Jesus (Crucified)
Plant associations: Almond, Angelica, Allspice, Basil, Bay, Calamus, Calendula, Carnation, Cedar, Citron, Clove, Copal, Cumin, Coriander, Dragon’s Blood, Eucalyptus, Fern, Fennel, Frankincense, Garlic, Gardenia, Galangal, Geranium, Heliotrope, Horehound (white), Honeysuckle, Heather, Hyssop, Lilac (white), Lime, Lemon Balm, Lavender, Lotus, Mallow (blue), Myrrh, Mistletoe (American), Mugwort, Mandrake (American), Orange (bitter), Orris, Peppermint, Pine, Patchouli, Pennyroyal, Peony, Rose (white), Rose Geranium, Rue, Sage (common), Sandalwood (white), Snapdragon, Thistle (greater), Thyme, Violet, Vervain, Vetivert, Valerian, Yarrow
Holiday: Feast of Our Lady of Mercy on September 24
Nigerian creator of humanity. He created the human body. His father, Olorun gives to that body the distinctly human soul (mind). His sister and wife and sister, Odudua, gave humanity the desire to procreate. In his African aspect he is also sky god (sometimes goddess). He migrated into Santeria where he is the Orisha of purity and light. In different traditions he was associated with both the Virgin Mary (Our Lady of Mercy) and her son Jesus.
Incense Recipe
2 parts Frankincense
2 parts Copal
1 part Clove
1 part Orris Root
1 pinch Mistletoe
Oil Recipe
10 drops Sandalwood oil
4 drops Clove oil
4 drops Frankincense oil
2 drops Cedar oil
1/2 ounce almond oil as a base
Obba—Female—African/Caribbean/South America
Saint association: St. Catalina
Holiday: Feast of Saint Catalina of Palermino on November 25
Orisha of both death and birth, she owns the cemeteries with Yeggua and Oya but also presides over sexual fertility, thus providing yet another example of the connection between Life and Death in a never-ending cycle.
Obbaloke—Male—African/Caribbean/South America
Saint association: St. Santiago
Holiday: Feast of Saint Santiago on July 25
Orisha of strength, he is patron of mountain climbers, the mountain itself, and anything that stretches into the sky.
Oceanus—Male—Mediterranean
(Also known as Okeanos)
Father: Uranus
Mother: Gaia
Wife: Tethys
Animal association: Snake
Initially a Greek personification of fresh water streams and rivers. He is called on for protection when traveling across and along fresh water. He fathered thousands of river nymphs with his wife and sister Tethys. Some references state that he and his wife adopted Hera when she was an infant. As his lore expanded, he became god of the ocean.
Ochosi—Male—Africa/South America
In Santeria, his name is Ochosi Odemata
In Voodoo, his name is Agao Wedo
In Africa, his name is Ochossi
Saint associations: St. Norbert, St. Albert, St. Hubert, St. James, St. Isidro, St. Sebastian Holiday: Feast of Saint Norbert on June 6 Plant associations: Allspice, Asafoetida, Anise, Basil, Broom, Coriander, Cumin, Clove, Deerstongue, Dragon’s Blood, Five Finger Grass, Galangal, Ginger, Hyssop, Honeysuckle, Mistletoe (American), Maple, Nettle (greater), Rosemary, Sage (diviner’s) Tobacco, Wormwood, Woodruff
In his African aspect, he is god of vegetation and divine justice. Migrating into Haitian Voodoo he becomes a loa of thunder. In Santeria, he is associated with many of the Catholic saints.
Incense Recipe
2 parts Dragon’s Blood
1 part Coriander
1 part Clove
Enough Ochosi or Rosemary oil to bind
Oil Recipe
8 drops Basil
6 drops Coriander
3 drops Clove
3 drops Rosemary
1/2 ounce base oil
Ocypete—Female—Mediterranean
’Swift Wing’—Greek Harpy who was charged with creating peace. In that capacity, she and the others are beautiful winged maidens (sometimes virgins). But to keep that peace, she and the others were also the punisher of crime. In that capacity, they are horrid winged beasts. One of the three Harpies. The other two are Celaeno and Aello.
Oddua—Male—African/Caribbean/South America
An avatar/incarnation of Obatala who participated in the creation of the world. He created and now administers justice. As such he is the patron of those who have been unjustly accused, but treats bitterly those unjust folk who call on him for assistance.
Odin—Male—North Europe
(Also known as All Father)
Father: Bor
Mother: Bestla
Wife: Frigga
Animal associations: Crow, Eagle, Falcon, Raven, Wolf, Horse, Dog, Bear
Plant associations: Alder, Almond, Ash, Beech, Benzoin, Cedar, Elm, Mistletoe (European), Olive, Patchouli, Yew
Scandinavian god who was lovingly called All Father. Much of his great wisdom came from two visits to the Yggdrasil (Tree of Life/ World Tree). On one visit, he asked Mimir for a drink of the streams that run from the Yggdrasil’s roots (Mimir’s Well). Mimir granted him that drink, but only at the cost of one of Odin’s eyes. From that experience, Odin received great knowledge of those who had gone before. On another visit, Odin hung from the World Tree for nine days and nights. From that visit, he received knowledge of runes. While there is a great amount of debate as to if the runes were first used for magick or for language, we see clearly a connection between Odin and the written language. Although commonly thought to be a god of war, Odin is also a patron of poetry, science, and magick. Odin and Thor can be seen to have many similarities, although Odin was the god of warriors, and Thor the god more akin to the common man.
Incense Recipe
2 parts Benzoin
2 parts Cedar
1 part Patchouli
1 pinch Mistletoe
Enough Odin or Patchouli oil to bind
Oil Recipe
8 drops Benzoin oil
6 drops Cedar oil
6 drops Patchouli oil
1/2 ounce Olive oil as a base
Odomankoma—Male—Africa
Ashanti Creator god who created death to prevent over population, thus allowing himself to die for the good of all. He can thus be seen as a sacrificial god.
Oeneus—Male—Mediterranean
Wife: Althea
Plant association: Vine (grape)
Greek man who received the grapevine from Dionysus in exchange for the sexual services of his wife Althea. He became the first man to create a vineyard in Greece. I believe this story is a warning that alcohol can be detrimental to the judgment of folk involved in monogamous relationships.
Oengus Mac Og—See Aengus Mac Og
Oghma Grainaineach—Male—Central Europe (Also known as Oghma)
Father: Dagda
Mother: Boann
Son: Delbaeth
Irish God who was said to have created/ received and give to humanity the Ogham. In this capacity, his story can be seen similar to that of Odin, both being scholars, warriors, and providers of an alphabet/magical written language. Oghma is an ideal patron deity of the modern high-tech soldier.
Oggue—Male—African/Caribbean/South America
Patron of all horned animals. Perhaps originally a Horned God of the hunt. He is described often as Shango’s companion.
Oggun—Male—African/Caribbean/South America
(Also known as Ogun)
In Santeria, his name is Oggun/Ogun
In Voodoo, his name is Ogu
In Africa, his name is Ogum
Saint and Catholic associations: St. Anthony, St. Peter, St. Paul, St. John the Baptist, St. James, St. George, St. Joan of Arc
Father: Aganyu
Mother: Yemaja
Holiday: Feast of Saint Peter on June 29
Plant associations: Angelica, Anise, Asafoe-tida, Basil, Bay, Bergamot (orange), Clove, Cypress, Cumin, Carnation, Caraway, Copal, Dragon’s Blood, Eucalyptus, Galangal, Heather, Hyacinth (wild), Hyssop, Honeysuckle, Juniper, Lotus, Lime, Lilac, Mandrake (American), Mistletoe (American), Mugwort, Myrrh, Orange (bitter), Orris, Peony, Patchouli, Rosemary, Rose, Sage (diviner’s), Violet, Vervain, Vetivert
Yoruba god of iron. With his associations to iron smithing, he became a god of fire and water. He migrated into Santeria where he became the Orisha who is called on to protect his followers from accidents.
Incense Recipe
1 part Dragon’s Blood
1 part Copal
1 part Juniper Berries
1 part Orris Root
Oil Recipe
8 drops Clove
6 drops Cypress
6 drops Cumin
Okaga—See Itokaga
Oko—Male—African/Caribbean/South America
Father: Aganyu
Mother: Yemaja
Plant associations: Allspice, Apricot, Almond, Angelica, Anise, Asafoetida, Basil, Bergamot (orange), Bay, Calamus, Calendula, Camphor, Coriander, Cumin, Corn, Coconut, Clove, Crocus, Deerstongue, Daisy, Ginger, Ginseng, Grains of Paradise, Galangal, Geranium, Heather, Hyacinth (wild), Iris, Jasmine, Lemon, Myrtle, Magnolia, Myrrh, Nettle (greater), Peppermint, Red Poppy (seed), Rosemary, Sandalwood (white), Tobacco, Willow, Pepper (black)
Saint association: St. Isidro
Holiday: Feast of Saint Isidro on March 22 and/ or May 15
African god who migrated with the slave trade and became one of the Orisha of the Santeria. Oko is Orisha of agriculture and the harvest. He is associated with fertility of the land. He is a deified ancestor.
Incense Recipe
3 part Sandalwood (white)
1 part Myrrh
1 part Jasmine
Oil Recipe
8 drops Sandalwood
6 drops Myrrh
4 drops Jasmine absolute or Lemon oil
2 drops Black Pepper oil
1/2 ounce base oil
O-Kuni-Nushi—Male—Far East
Father: Susanowo
Wife: Suseri-Hime
Japanese god of medicine and patron of healers, doctors, and especially folk who work with herbal medicine.
Old Spider—Female—Malaysia
Nauru Island creator of the moon, sun, Earth, and sky.
Old Woman—Female—North America
(Also known as Old Woman Who Never Dies)
Animal associations: Goose, Swan, Duck
Madan Crone goddess associated with fertility.
Oloddumare—Male—African/South America (Also known as Olofi)
Supreme god of the Santeria from whom the Orisha receive their attributes and powers. In his many aspects he has been given many names:
Olorun—Owner of Heaven.
Olorun Oloddumare—The Lord who lives in Heaven.
Eledaa—The Creator
Elemi—Owner of Life
Alaaye—The Living One
Olojo Oni—The master of daily events Olofi—God of the Earth and protector of crops.
But one name/aspect is most commonly used, that being Olofi. In his role as god on Earth, he is the aspect of Oloddumare most related to by humanity. In the blending of Yoruba and Christian traditions, he becomes associated with Jesus Christ. However, he is not prayed to directly for any one need or want, that job being delegated to the Orishas (his children).
Olocun—Male—Africa/South America
(Also known as Olokun)
Father: Aganyu
Mother: Yemaja
Plant associations: Allspice, Angelica, Anise, Apple (blossom), Almond, Bergamot (orange), Bay, Calamus, Chamomile (common), Cumin, Camphor, Coconut, Caraway, Crocus, Dragon’s Blood, Elder, Jasmine, Lotus, Lavender, Lemon Grass, Lemon Verbena, Magnolia, Myrtle, Myrrh, Mandrake (American), Peppermint, Red Poppy (seed), Sandalwood (white), Spearmint, Thyme, Willow, Watermelon
Yoruba ocean god who migrated with the slave trade to become the Orisha Olocun of Santeria.
Incense Recipe
2 parts Sandalwood
2 parts Dragon’s Blood
1 part Jasmine or Lemon Grass
1 part Lavender
1 part Chamomile
Oil Recipe
8 drops Sandalwood
6 drops Jasmine Absolute or Lavender oil
6 drops Lemon Grass oil
1/2 ounce base oil (almond oil is best)
Olorun—Male—Africa
Nigerian creator of Obatala and Odudua (Nigerian/Yoruba Adam and Eve). Patron of parents with wildly different children.
Olwyn—Female—Central Europe
Husband: Culhwch
Plant associations: Apple, Hawthorn
Welsh goddess of Spring and Summer.
Omacatl—Male—Central America
’Two Reeds’—Aztec god of bliss and happiness whose body and bones are symbolically eaten with great joy at his holiday. However, he was certainly a trickster god and while his blessings were many, they only came when he was given great respect. May be an aspect of Tezcatlipoca.
Omeciuatl—Female—Central America (Also known as Omecihuatl)
Husband: Ometeuctli
Aztec Creator goddess.
Ometeuctli—Male—Central America
(Also known as Ometeoltloque, Ometecutli, Tloque Nahuaque, Citlatonac)
Wife: Omeciuatl
’Two Lords’—Aztec Creator. Like Diana and many others, he brought his mate into existence by separating her from him. Interestingly enough, he has no formal following and no cult. Instead he is seen as being found in every deity, in every rite, in all of creation. He is, in essence, the very concept of the Nameless One. His name, like Diana, only applies to the male aspect after separating his mate from himself.
Onatha—Female—North America
Plant association: Wheat
Iroquois personification of Spring, Summer, the harvest, and goddess of wheat who was kidnapped and hidden in the Underworld. Her story is incredibly similar to that of Persephone and yet they took place continents away. Both Onatha and Persephone were daughters of a chief mother goddess (Demeter in the Greek story and Eithinoha in the Iroquois story). Both were kidnapped by an Underworld being (Hades in the Greek story and a Demon in the Iroquois story). Both were rescued on the orders of a greater deity (Zeus sent Hermes in the Greek story and the Sun sent his rays in the Iroquois story).
Ooyarrauyamitok—Male—Arctic America
Eskimo god who assists hunters in finding only that which is necessary to perpetuate life. Supports the observation that for life there must be death. Patron of hunters.
Ops—Female—Mediterranean
(Also known as Opis)
Husband: Saturn
Roman fertility goddess. Her holidays also include Saturnalia, which is cited to her husband Saturn more than herself. With her inclusion at the Opalia which overlaps Saturnalia, it is clear that their marriage was just as much a part of the Saturnalia as one’s family is part of the holidays during that same time of the year. Her name means ’plenty,’ however she demonstrates the need to sacrifice, as she was not only associated with harvest, but also with the planting and care of a the crop. That work was sacrifice to her.
Oraea—Female—Mediterranean
Holiday: Summer Solstice
Roman Summer goddess who is celebrated at the peak of the sun.
Orestes—Male—Mediterranean
Father: Agamemnon
Mother: Clytemnestra
Greek god of revenge. After his father was killed by his father’s adulterous wife and her lover Aegisthos, Orestes plotted revenge with his sister Electra. After following through with their bloody plot, he had successfully killed both Clytemnestra and her lover. As a result, he was followed and harassed by the Furies until of his own accord he sought judgment at the Aeropagus in Athens. There, he was acquitted and upon his seeking judgment, the Furies discontinued their harassment.
Orpheus—Male—Mediterranean
Father: Apollo
Mother: Calliope
The greatest Greek musician. His music is said to be able to calm raging animals and cause inanimate things to dance.
Orunjan—Male—Africa
Father: Aganyu
Mother: Yemaya
Yoruba god of the mid-day sun.
Orunla—Male—African/Caribbean/South America
In Santeria, he is known as Orunmila/Ifa
In Voodoo, he is known as Orunla
In Africa, he is known as Orunmila
Saint and Catholic association: St. Francis of Assisi
Holiday: Feast of Saint Francis of Assisi on October 4
Plant associations: Anise, Allspice, Cinnamon, Carnation, Coconut, Calamas, Citron, Camphor, Calendula, Dittany of Crete, Dragon’s Blood, Five Finger Grass, Ginger, Heliotrope, Honeysuckle, Jasmine, Lilac, Lemon Grass, Orris, Sandalwood (white), Sage (common), Wormwood
Yoruba god who became one of the Orisha of the Santeria. He is the Orisha of great prophecy and divination. Considered a divine spirit. In the mixing of Yoruba and Christian traditions, he became associated with Saint Francis of Assisi.
Incense Recipe
3 parts Sandalwood (white)
2 parts Dragon’s Blood
1 part Jasmine flowers
Oil Recipe
12 drops Sandalwood oil
6 drops Jasmine absolute or Lemon Grass oil 4 drops Cinnamon oil
1/2 ounce base oil
Osain—Male—African/Caribbean/South America
Saint and Catholic associations: St. Sylvester, St. Anthony Abad, St. Ambrose, St. Joseph, St. John (San Jose), St. Benito, St. Raymond (Palo)
Holidays: Feast of Saint Sylvester on December 31, Feast of Saint Anthony Abad on January 17
African god of Nature who migrated into Santeria, without a name change, to become the patron of herbalists and doctors.
Oshun—Female—African/Caribbean/South America
Also called Carida
In Santeria, her name is Oshun/Ochun
In Voodoo, her name is Erzulie
In Africa, her name is Oshun
Plant association: Basil, Cardamom
Saint and Catholic associations: Our Lady of Charity, Our Lady of Caridad del Cobre Mother: Yemaya
Husband: Shango
Holiday: Feast of Our Lady of La Caridad del Cobre on September 8 (Our Lady of Charity)
The connection between Oshun and Erzulie should not be considered fact. There are some who consider the connection to be just as solid as the connections made between the Greek and Roman gods. Others insist that Erzulie (aka La Siren) has no connection to Oshun. In Africa she is goddess of love, beauty, and fresh water rivers. One of two sisters who were the wives of Shango (the other is Oya). She is described as beautiful and jealous of her husband’s love of her sister (his other wife), Oya. With migration into Voodoo and Santeria, she became associated primarily with beauty.
Osiris—Male —Africa
(Also known as Usire) Wife: Isis
Lovers: Nephthys
Animal associations: Chicken (cock), Ostrich, Hawk, Goose, Heron, Vulture, Leopard, Antelope, Cattle (bull), Ram, Horse (Pegasus), Dog, Swallow, Panther
Plant associations: Acacia, Benzoin, Cedar, Clove, Dittany of Crete, Ivy (common), Orris, Palm (date), Tamarisk, Vine (grape), Willow, and all old world grains
Egyptian Earth God who is associated with not only the Underworld, but also with resurrection and fertility. In essence, he is to Isis what Geb is to Nut, who were also parents to both Osiris and Isis, indicating a cycle of rebirth.
Incense Recipe
1 part Acacia flowers
1 part Benzoin
Enough Osiris or Benzoin essential oil to bind
Oil Recipe
12 drops Benzoin essential oil
18 drops tincture of Acacia
1/4 ounce Olive oil
Otsuchi No Kami—Female—Far East
Japanese Earth Mother.
Ovinnik—Male—Central Europe/Northern Europe
Animal association: Cat (black)
Baneful spirits who set fire to homes.
Oya —Female—African/Caribbean/South America
In Santeria, her name is Oya/Olla/Yansa
In Voodoo, her name is Aida-Wedo/Brigette In Africa, her name is Oya/Odo-Oya
Saint and Catholic associations: Our Lady of La Candeleria, Our Lady of Mount Carmel, St. Catherine, St. Theresa
Mother: Yemaja
Husband: Shango
Plant associations: Anise, Aspen (American), Cinnamon, Carnation, Calamus, Clove, Dragon’s Blood, Dittany of Crete, Hibiscus, Lemon, Lime, Myrrh, Nutmeg, Oakmoss, Star Anise, Sandalwood (white), Tangerine Holiday: Feast of Our Lady of Candlemas on February 2
In Africa, she is goddess of wind and lightning. Sometimes seen to also preside over water and fertility. One of two sisters who were the wives of Shango (the other is Oshun). She is described as plain-looking and jealous of her husband’s love of her sister (his other wife) Oshun, as well as her beauty. In Santeria and Voodoo, she is the Orisha of the Winds and of the entrance to cemeteries.
Incense Recipe
4 parts Sandalwood (white)
2 parts Gum Arabic
1 part Dragon’s Blood
1 part Clove
1 part Lemon (peel)
Enough Oya or Sandalwood oil to bind
Oil Recipe
8 drops Sandalwood
4 drops Lemon
4 drops Clove
4 drops Cinnamon
1/2 ounce base oil
Pachacamac—Male—South America
Wife: Pachamama
’Earth Maker’—Inca Creator but not exactly friend of humanity. He created the first man and woman, and then forgot to feed them. The man died first, so the woman complained about the god that was also an unfit father. Pachacamac caused her to become pregnant. When her first son was born, Pachacamac cut the child in half and used the body parts to create the plants of this world. He told her to dine. When her second son escaped he killed the woman, but her son came back to avenge his mother’s death, driving their creator into the sea.
Pachamama—Female—South America
(Also known as Mama Pacha) Husband: Pachacamac
Chincha/Inca Earth Mother. Pachamama formed her husband, Pachacamac, from herself the way Diana formed her lover Lucifer. Pachacamac then created the world, and she became a fertility goddess associated with cultivation.
Padma, Dakinis—Female—Central Asia
Dakinis Padma is the Tibetan goddess associated with the West, fascination, and affection. See also Vajra, Ratna, Karma, and Buddha.
Pales—Male/Female—Mediterranean
Animal associations: Cattle, Donkey, Vulture
Roman deity who was originally described as male, but who with time transformed into a female. S/he was the protector of both field and flock. Sometimes cited by the transgender community as an example of a transgender deity, due to the transition from male to female. His name comes from the Greek and Latin word phallus, which translates to penis.
Pan—Male—Mediterranean
Animal associations: Antelope, Eagle, Bee, Panther, Goat, Sheep (ram), Turtle, Tortoise, and in general all creatures of the wild.
Plant associations: Fennel, Fern, Fig, Myrrh, Oak, Olive, Patchouli, Pine, Reeds (all), Thistle, and meadow flowers.
’Everything’ or ’All inclusive’—Greek Horned God of the woods who, in the ancient world, was almost always depicted with an erect penis. That symbolism seems to have faded, giving us the boyish and almost innocent image that we have today. Ancient lore tells a different story. There Pan remains the lustful god of the woods who chased after both men and women with whom he sought to fulfill his endless sexual desires. Of women, he preferred nymphs (especially virgins) and of the men he preferred shepherds.
Incense Recipe
4 parts Pine needles (or 1 part pitch and 3 parts Sandalwood powder)
4 parts Myrrh
Enough Pan or Myrrh essential oil to bind
Oil Recipe
9 drops Pine essential oil
6 drops Myrrh essential oil
3 drops Patchouli essential oil
1/2 ounce Olive oil
P’an Chin Lien—Female—Central Asia
Chinese spirit. Protector and patron of prostitutes.
Pandora—Female—Mediterranean
’All gifted’—Greek woman who unknowingly released baneful emotions/spirits from a box given to her by Zeus. This was Zeus’ revenge on Prometheus for having stolen fire and given it to humanity. Wiccans have built on this story with the practice of the Outsider Offering, a time during ritual when baneful emotions and thoughts are symbolically removed from the circle, sometimes being placed in a mirrored box.
P’an Ku—Male/Female—Central Asia (Also known as Pan Gu)
Animal association: Tortoise
Chinese deity born of an egg who was both the Yin and the Yang of creation. The top part of the egg grew into the Yang, forming the heavens as it did. The bottom half grew into the Yin, forming the Earth as it did. S/he kept growing for thousands of years, pushing the Yang and Yin apart until s/he split into two. His eyes became the sun and moon, his shoulders the mountains. His blood became the rain. Her womb became the oceans, filling with his blood. Her belly became the Earth. Her feet became the islands. She is always pregnant and always birthing life.
Paris—Male—Mediterranean
Greek shepherd who later became a prince. Paris sided with Aphrodite, thus starting the Trojan war, killed Achilles during that war, and then died himself. See Peleus.
Parjanya—Male—Near East
Father: Kashyapa
Mother: Aditi
Parjanya is one of the Adityas. The Hindu month Shravana (July 23-August 22) is sacred to Parjanya. See Adityas.
Papa—Female—Polynesian Islands Husband: Rangi
New Zealand Earth Mother. With her husband Rangi, Sky God, the pair contribute greatly to the use of the Wiccan terms Father Sky and Mother Earth.
Parasurama—Male—Near East
(Also known as Parashurama)
Animal associations: Ape, Swallow
Plant associations: Benzoin, Gum Mastic, Mace, Sandalwood (white), Vervain, Marjoram, Palm (date)
Hindu sixth avatar of Vishnu. He once served Lord Shiva. During such service, Shiva gave to him an axe. Later, he went to seek advise of Lord Shiva, but Ganesha would not allow him access to his Lord. In anger, he threw his axe at Ganesha, who could surely have allowed the axe to pass without harm. Realizing the axe had been given to the young Parasurama, Ganesha allowed it to sever the tip of one of his tusks. This is why Ganesha is typically shown with one tusk that still has a point and the other with the point cut off.
Parvati—Female—Near East
Father: Himavat
Husband: Shiva
Animal association: Dove
Hindu goddess who is either one of Shiva’s many lovers, or (as I believe) Shiva’s wife who has many avatars/incarnations, including: Ambika, Bhairavi, Durga, Gauri, Kali, Sati, and Uma. Parvati can be seen as a Creator goddess, independent of Shiva, as her son Ganesa was created when she blessed dust with the fluids of her body. Because it was clear that in union there were none who could effectively stand against Parvati and Shiva, when she won Shiva’s mind, body, and soul the Earth trembled in the quake of their love.
Pashadhari—Female—Near East
Husband: Yama
Hindu mother goddess whose symbol is the noose, associated with creation (penis and vagina) and birth (vagina and umbilical chord), much as the ankh is.
Pasiphae—Female—Mediterranean
Father: Helios
Mother: Cymene
Husband: Minos
Plant association: Ivy (common)
When her husband, King Minos, insulted Poseidon, he took his revenge by causing Pasiphae to fall deeply in love with a bull. Such was her lust for that bull that she commissioned the construction of a contraption that would allow her to mate with it. She did and later gave birth to Minotaur. Ah, now that is revenge.
Patecatl—Male—Central America
Aztec god of healing and fertility. He is also associated with intoxication and revelry, particularly fond of alcohol intoxication.
Patol—Male—Central America
Wife: Alaghom Naum
Mayan god of the Tzental tribe. Sometimes cited as the Mayan chief god.
Pax—Female—Mediterranean
(Also known as Pax Augusta)
’Peace’—Roman personification of peace. One of her holidays falls on the day the United States celebrates its independence, perhaps a hint that peace is sometimes achieved only after standing against oppression.
Peitho—Female—Mediterranean
Father: Hermes
Mother: Aphrodite
’Persuasion’—Greek personification of persuasion and seduction, especially sexual seduction.
Peleus—Male—Mediterranean
Father: Aeacus
Son: Achilles by Thetis
Wife: Thetis
Greek god who married Thetis, but did not invite Eris (Discordia). Some say the invitation list was made by Zeus, but certainly Peleus could have objected to the lack of inclusion. Eris respected the fact that she was not invited, but sent a gift of a golden apple to the feast, on which was written kallisti, which means ’to the prettiest one.’ Athena, Hera, and Aphrodite all made claim to the apple insisting that each was ’the prettiest one.’ To settle the argument, Zeus appointed Paris of Troy as arbitrator. Each tried to bribe Paris. Athena offered of victory at war. Hera offered him wealth. Aphrodite offered him the prettiest woman on Earth. Being a simple man, he decided love was more important than either victory or wealth. In that decision, Aphrodite did honor her bribe. She gave him the prettiest woman on Earth. That woman was Helen who was, unfortunately for many, married at the time to Menelaus (King of Sparta). Menelaus, not being fond of having his wife kidnapped, took his wife back and declared war on Troy. In that war, Paris sided with Troy and Achilles sided with Sparta. The result was that Achilles fell when Paris struck him in the heal with an arrow, and later Paris died himself. If you are considering a large wedding and you are not sure everyone in attendance will play nice, the moral here is to elope!
Penates—Male/Female—Mediterranean
(Also known as Di Penates)
’The Inner Ones’—Roman guardians of storage rooms and the pantry who later became the personal guardians of the home. They are praised and made sacrifice to by offering them a bit of each meal by throwing a portion of food into the fireplace.
Perse—Female—Mediterranean
(Also known as Persa, Perseis)
Lover: Helios
Greek sea nymph (one of the Oceanids) and mother of Perses and Aeetes by Helios.
Perses—Male—Mediterranean
Father: Helios
Mother: Perse
Wife: Asteria
Greek father of Hecate by his wife Asteria.
Persephone—Female—Mediterranean
(Also known as Kore)
Father: Zeus
Mother: Demeter
Lover: Hades
Animal associations: Bat, Boar, Ground Hog, Snake
Plant associations: Dittany of Crete, Ivy, Lily, Narcissus, Parsley, Pomegranate, Willow
Greek goddess of the Underworld. When she was young, all the eligible and a few ineligible men wanted her hand (as well as everything attached to it). So lustful was Hades of her that he broke open the Earth and kidnapped her, forcing her to be his queen in the Underworld. So heartbroken was her mother, Demeter, that she wandered the Earth until finally Zeus told her what had happened. So full of remorse was Demeter that she withdrew from the Earth and hid in seclusion. As she was the goddess of fertility, all growth stopped and the Earth became barren. Realizing the Earth and its inhabitants would die without Demeter, Zeus sent Hermes to recover Persephone. The story changes somewhat in its different incarnations. In one a deal was struck with Hades. In another, Persephone had eaten food from the Underworld so was trapped there and could only return to the surface for half of the year, or she would die. Whichever version one chooses, the result is the same. Persephone returns to the Underworld every Fall and then back to the Earth in the Spring. During her stay in the Underworld, her mother withdraws all fertility from the Earth, thus yielding Winter. See Minth for lore that supports the idea that Persephone had in fact fallen in love with Hades.
Perseus—Male—Mediterranean
Father: Zeus
Mother: Danae
Wife: Andromeda
Greek folk hero who rescued Andromeda from a sea monster and later married her. He is most noted for the killing of Medusa and then for the creation of Atlas Mountains when he showed Medusa’s head to Atlas, thus turning Atlas into stone.
Persipnei—Female—Central Europe
Lover: Eite
Etruscan goddess similar to the Greek Persephone.
Peruda—Male—South America
Brazilian creator who was chiefly responsible for human consciousness, especially in matters of love and procreation. One of the three Creators responsible for the world. The other two were Jacy and Guaracy. In Wicca he is associated with mind and the third order of life (humanity).
Perun—Male—Central Europe
(Also known as Peroun)
Animal associations: Cock, Goat, Bear, Bull
Slavic god of storms. He was worshiped in Russia well into the second millennia despite Russia’s official adoption of Christianity around the turn of the first millennium c.e.
Phaeton—Male—Mediterranean
(Also known as Phaethon)
Father: Helios
Mother: Cymene
’Shinning one’—Greek god who flew his father’s sun chariot too close to the Earth, creating the great deserts by setting fire to the Earth. Helios killed him to protect the Earth.
Phebele—Male—Africa
Wife: Mebeli
Congo father of the first man. See Massim-Biambe.
Phosphorus—Male—Mediterranean
One of the Greek gods who became the personification of the planet Venus (the morning star).
Picunnus—Male—Mediterranean
Roman god who, with his twin brother Pilumnus, protected the life and health of newborn babies.
Picus—Male—Mediterranean
Roman god of agriculture and prophecy.
Pidrai—Female—Middle East/Mediterranean
Canaanite Goddess of Light. One of the aspects of the Canaanite’s Triple Goddess whose name means ’Maiden of Light.’ See also Arai and Tallai.
Pilumnus—Male—Mediterranean
Roman god who, with his twin brother Picunnus, protected the life and health of new born babies.
Pietas—Female—Mediterranean
’Dutifulness’—Roman personification and goddess of duty to the gods, community, and family. Similar to Dharma (Hindu God) and representative of the principle presented in the Wiccan Rede as will. Her temple at the foot of the Capitoline Hill dates from the beginning of the second century before common era.
Pleione—Female—Mediterranean
Lover: Atlas
Greek mother of the Pleiades.
Pluto—Male—Mediterranean
Wife: Proserpina
Plant associations: American Aspen, Common Aspen, Cypress, Fig, Frankincense, Hibiscus, Hyssop, Mint, Nettle (greater), Oak, Olive, Peppermint, Pomegranate, Red Poppy, Saffron (Spanish), Poppy (white)
’Wealth’—Roman god of the Underworld. The etymology of his name, ’wealth,’ reminds us that the Underworld is not only seen as the place of the dead, it is also the place where the riches of the Earth are found. His real name was a hidden secret, never spoken because folk were afraid it would attract his attention, and without the aspect of wealth he was not all that welcome.
Incense Recipe
1 part Hibiscus flowers
1 part Poppy flowers
1 part Frankincense
1 pinch dried Figs (optional)
Enough Pluto or Peppermint essential oil to bind
Oil Recipe
9 drops Frankincense essential oil
6 drops Peppermint essential oil
6 drops Cypress essential oil
1/2 ounce Olive oil
Pollux—Male—Mediterranean
Father: Zeus
Mother: Leda
See Leda for the story of his conception. With his twin brother Castor, he was called the Disocuri.
Polyhymnia—Female—Mediterranean
’Many songs’—Greek muse of song, dance, and mimicry. She is often shown with a finger to her lips as if in deep thought. See also Muses, The.
Pomona—Female—Mediterranean
Plant association: Apple
Roman goddess and patron of the orchard, especially apple orchards.
Pooka, The—Male—Central Europe
Animal association: Black Horse
Celtic/Pre-celtic spirit who curses all crops not harvested by Samhain. Probably the origin of Puck (Robin Goodfellow) in Shakespeare’s play A Midsummer Night’s Dream.
Porrima—Female—Mediterranean
Roman goddess of divination and prophecy. With her sisters Postvorta and Carmenta she is seen as a Triple Goddess.
Portunes—Male—Mediterranean
(Also known as Portunus, Portunis, Portuno)
Roman god of keys, entrances, and domestic animals (especially guardian animals/watch-dogs). As sea trade often involved the secure storage of crops in ports, he became a god of harbors. He is honored by some with the wearing of an old fashioned key or key-like charm.
Poseidon—Male—Mediterranean
Father: Cronos
Mother: Rhea
Wife: Amphitrite
Lover: Gaia, Leucippe, Telephassa
Animal associations: Horse, Cattle (bull), Dolphin, Fish, Whale, Shark and all creatures of the sea
Plant associations: Ash, Bladderwrack, Cedar, Fig, Lotus*, Myrrh, Olive, Pine, Seaweed (all), Water Lily
* May have been connected to Lotus due to the folk name use of the term Water Lily.
Greek god and ruler of the ocean who lived there with his wife. He forms a sacred triad with his brothers Zeus (land/upper world) and Hades (Underworld).
Incense Recipe
1 part Cedar powder
1 part Myrrh (sweet myrrh is best)
A pinch of sea salt
Enough Poseidon or Myrrh essential oil to bind
Oil Recipe
9 drops Cedar wood essential oil
6 drops Myrrh essential oil
1/2 ounce olive oil
Postvorta—Female—Mediterranean
Roman goddess of history and of seeing the past for what it is rather than for how one wishes to picture it. With her sisters Carmenta and Porrima she is seen as a Triple Goddess.
Prajapati—Male—Near East
Animal association: Tortoise
Hindu god and patron of parents.
Protogonos—Male—Mediterranean
Phoenician god and father to the first of humanity. His name means ’first born,’ his wife’s name means ’life,’ his children are the combination of the two, giving us ’first born life.’
Priapus—Male—Mediterranean/Middle East Father: Dionysus
Mother: Aphrodite
Animal associations: Bee, Goat, Donkey
Plant associations: Myrrh, Olive, Pine, Thistle
Greek fertility god who was honored with statues carved out of wood and sporting huge penises. He protects and overseas family gardens and animal husbandry, granting fertility to both endeavors.
Incense Recipe
4 part Pine needles (or 1 part pitch and 3 part sandalwood)
4 parts Myrrh
4 parts Gum Arabic
Enough Priapus or Pine essential oil to bind
Oil Recipe
9 drops Pine essential oil
6 drops Myrrh essential oil
1/2 ounce Olive oil
Pritha—Female—Near East
Lover: Dharma
Hindu goddess. Some cite her as Dharma’s close friend, others as his lover.
Prithvi—Female—Near East
Husband: Dyaus
Animal association: Cattle (cow)
Hindu Earth Mother and fertility goddess.
Priti—Female—Near East
Hindu personification of joy.
Prometheus—Male—Mediterranean
Animal association: Coyote
Plant associations: Dragon’s Blood, Fennel seeds
Greek god of divination who created man of clay. Athena then breathed life into them. Because his brother had given animals everything he was allowed to give humanity, he gave us something he was not allowed to give: fire. So concerned was Zeus that humanity might become gods themselves with fire, he took fire back from humanity. In response, Prometheus stole the fire from Zeus and secreted it back to humanity. When Zeus discovered the theft, he sent Prometheus to be tortured daily, and to humanity he sent Pandora with her box of misfortune. In this story, we see why so many Wiccans hold to the use of the athame rather than the wand. It takes fire to create the athame, thus denoting the separation between humanity and other animals who use sticks as tools.
Incense Recipe
2 part powdered Fennel seed
1 part Dragon’s Blood
1 part Gum Arabic
No need for an oil to bind this one
Oil Recipe
1 part Fennel Seed oil
1 part Dragon’s Blood perfume oil
Proserpina—Female—Mediterranean
Animal associations: Bat, Boar
Roman goddess who equates to the Greek Persephone.
Psyche—Female—Mediterranean
Plant associations: Dittany of Crete, Ivy, Lily, Willow
’Soul’—Greek goddess who deeply loved Eros as did he love her, but she broke a promise to him which seemed a bit silly. He insisted that if they were to be lovers, it could only be at night with no light on the union. Although she thought the request was silly, she agreed. Later, she broke her promise and shed light on their lovemaking. He left her, deeply hurt by her actions. She later won him back, but not before much grief, both hers and his. Their story tells us that even when we think our lover’s requests are silly, if we fail to honor them we risk hurting both ourselves and our lovers.
Ptah—Male—African
Wife: Sekhmet
Animal associations: Cattle (bull), Donkey, Hawk
Plant associations: Almond
’Creator’—Egyptian god and patron of folk who create with their hands. He is sometimes seen as an All Father of the other gods, having created them all.
Pukkeenegak—Female—Arctic North America
Eskimo goddess of conception, child birth, and the making of clothing (especially for children)
Pusha—Male—Near East
(Also known as Pushan)
Father: Kashyapa
Mother: Aditi
Hindu god of relationships in the order of all things, casual or personal, living or not living. One of the Adityas. The Hindu month Pausa (December 22-January 20) is sacred to Pusha. See Adityas.
Pyrrha—Female—Mediterranean
Husband: Deucalion
Greek goddess who survived the Great Flood. See Deucalion.
Queen Maya—Female—Far East
Mother of the Buddha.
Quetzalcoatl—Male—Central America (Also known as Quezalcoatl)
Animal associations: Hummingbird, Dog, Lizard, Snake
Aztec and Toltec god of wind, fertility, and knowledge. He invented methods of negotiating with Nature, as well as the calendar by which his people could predict the seasons. With Mayauel, he brought love to humanity.
Quezalcoatl—See Quetzalcoatl Quirinus—Male—Mediterranean
Wife: Hora
Roman god of community and state. Most likely an avatar/incarnation of Mars as Mars Quirinus. No longer a god of war in this incarnation, he is more of a father figure.
Ra—Male—Africa
(Also known as Re)
Animal associations: Cat, Duck, Falcon, Hawk, Lion
Plant associations: Acacia, Bay, Cinnamon, Frankincense, Heliotrope, Myrrh, Olive, Sunflower, Vine (grape)
Egyptian predecessor to Amun-Ra who was actually a fusing of two gods, Amun and Ra, due to a political merging of cultures. Ra is a sun god and Supreme God of the Heliopolis pantheon. In his aspect as Atum-Ra we see that although typically cited as male, Ra, is cited as generating the first gods from himself. Because this creation comes in a form devoid of the human attributes of procreation, he can be seen as being neither male nor female. He can also be associated with the Fifth Element in the Wiccan belief system in that even though he was neither male nor female at the point of creation, he was driven to create. In his case he is said to have created Tefnut and her mate Shu through masturbation. They intern united in the Great Rite and formed Nut and Geb, thus giving us the four Quar-ters/Elements, as well as the Fifth Element (heart/spirit) that brings on the act of sex, the principle of both separation and union.
Rabefihaza—Male—Madagascar
Madagascan folk hero who taught man how to negotiate with Nature for meat and fish. He invented the snare trap. Patron of those who fish and trap for food.
Radha—Female—Near East
Holiday: September 1st
Hindu avatar/incarnation of Lakshmi as Krishna’s favorite mortal lover, or maybe wife.
Rahula—Female—Far East
Father: The Buddha
Mother: Yasodhara
Son of the founder of modern Buddhism. See Buddha, The.
Rainbow Snake—Male/Female—Australia
Australian Aborigine god who was cited as male in some areas and female in other areas. S/he was seen as a life giving deity of fertility in the order of bringing rain, which fertilized the land and gave life to all creatures.
Raka (1)—Female—Near East
Hindu moon goddess associated with the full moon.
Raka (2)—Male—Polynesian Islands
Polynesian god of the wind.
Rakini—Female—Near East
Hindu goddess associated with the Swadishthana chakra (genitals). Sometimes described as an aspect of Shakti. See also Dakini, Lakini, Kakini, Sakini, and Hakini.
Raktavija—Male—Near East
Hindu demon general who led the attack against humanity that Kali put down. Kali is often depicted with Raktavija’s head in her hand, so we know how that war ended.
Rama—Male—Near East
Wife: Sita
Hindu seventh avatar/incarnation of Vishnu.
Ran—Female—Scandinavian
Husband: Aegir
Animal associations: Fish and all creatures of the sea.
’The Ravisher’—Ran brought bad weather to sailors. Her daughters furthered her efforts by tempting sailors unto their death. She rules the Underworld at the bottom of the ocean. Should men die by drowning, they become an honored guest in her domain.
Rangi—Male—Polynesian Islands
(Also known as Hanui-o-Rangi)
Wife: Papa
New Zealand Sky God. With his wife Papa, Earth Goddess, the pair contribute greatly to the use of the Wiccan terms Father Sky and Mother Earth.
Raphael—Male—Middle East/Mediterranean
Semitic God of Air. Archangel who is associated with the East Quarter in Wiccan, Gnostic, and Ceremonial rituals. The other Quarters are presided upon by Michael, Gabriel, and Auriel.
Rati—Female—Near East
Father: Dyaus
Mother: Prithvi
Husband: Kama
’Pleasure’—Hindu goddess of sexual delight. See Kama.
Ratna, Dakinis—Female—Central Asia
Dakinis Ratna is the Tibetan goddess associated with the South, compassion, and all things precious. See also Vajra, Padma, Karma, and Buddha.
Ratri—Female—Near East
Hindu goddess of darkness and the night. Her sister is Ushas (Dawn).
Ravana—Male—Near East
Animal association: Donkey
Demon king who kidnapped Sita only to find the revenge of her husband, Rama, at the end of a sword.
Raven—Male—North America
Animal association: Raven
Common to Native American tribes of the Pacific North West. Similar to Coyote of other tribes. Raven, like Coyote, is a trickster god. However, although a trickster, Raven also created humanity from wood and clay. Now humanity waits to see if we too were one of his tricks. Time will tell.
Re—See Ra
Remus—See Romulus
Renenet—Female—Africa
Animal associations: Lion, Snake (serpent)
Egyptian goddess of breastfeeding who is present at birth and death—at birth to nurture and at death for judgment. She is the personification of fortune, but is usually accompanied by her sister Shai (Fate).
Rhadamanthus—Male—Mediterranean
Father: Zeus
Mother: Europa
Animal association: Elephant Plant association: Aloe
Greek god of justice, wisdom, and education. He became one of the judges of the Underworld. Not a patron of those fairly accused of a crime or those who would defend them as he is associated with justice, not simply winning.
Rhea—Female—Mediterranean
(Also known as Dindumene)
Lover: Cronos
Animal associations: Bee, Crow, Wolf
Plant associations: Cypress, Myrrh, Oak, Pine, Poppy (white)
Greek mother of many of the gods. She gave birth to Demeter, Hades, Hera, Hestia, Poseidon and Zeus. When her husband and brother, Cronos tried to kill her children to prevent them from becoming more powerful than he, she tricked Cronos into missing Zeus. Cronos swallowed the others. When Zeus came of age, he overpowered his father, took his throne, and forced him to vomit up the other children, ushering forth the new pantheon as he did. Rhea is an Earth Mother who was worshiped with wild orgies and indulgences in wine and other intoxicants.
Rhiannon—Female—Central Europe Animal associations: Blackbird, Horse (white), and to some extent, all birds.
Welsh fertility goddess and patron of the falsely accused. She was once punished for the murder of her son, but was later discovered to be innocent.
Robin Good Fellow—Male—Central Europe Plant association: Bachelor’s Buttons
Potentially another name for Puck. Perhaps two separate deities merged into one by
Shakespeare, or maybe built on the lore of the Pooka.
Robigo—Female—Mediterranean
Husband: Robigus
Roman goddess who is called on to prevent the blight of crops by calling her attention to the weapons of war. Her name loosely means decay, and by drawing her attention to the weapons of war one brought on the rust of those weapons rather than the blighting of crops. Perhaps a commentary on the destructive nature of war on the infrastructure of a nation. Let the weapons rust and the crops will do well. She is sometimes cited as a female avatar/incarnation of Robigus, other times as his wife.
Robigus—Male—Mediterranean
Wife: Robigo
Roman god who protected grain crops from disease. Often worshiped with Flora. See Robigo, the goddess who is sometimes cited as his wife and other times cited as a female avatar/incarnation of Robigus. Their functions were shared.
Romulus—Male—Mediterranean
Father: Mars
Mother: Rhea Silvia
Mother: Acca Larentia (adopted)
Animal association: Wolf
With his brother Remus, he was the founder of Rome who was later deified. He was forced to kill his brother Remus after Remus started a horrible dispute over the naming of a new city they had hoped to found.
Roua—Male—Polynesian Islands (Also known as Ra)
Lover: Taonoui
Son: Fati by Taonoui
Father of the stars as seen by his followers on Society Island.
Ru Shou—Male—Central Asia
(Also known as Ju-Shou) Animal association: Dragon Holiday: Autumn Equinox
Chinese messenger who arrives from the west to bring bad news from the sky god with each sun set. He is associated with the Fall. His counterpart is Gou Mang.
Rudra—Male—Near East
(Also known as Nilakantha)
Animal associations: Cattle (bull), Boar, and all creatures of the wild.
’Howler’—Pre-Hindu personification of untamed Nature as seen in the power of thunderstorms and wild animals. Because he was being viewed by folk who had become accustomed to city life, he was associated with death. In a way, he is the male opposite of the loving, life-giving modern view of Mother Nature. As the Hindu religion developed, he became similar to Mother Nature and became associated with the life giving attributes of wild animals who were hunted and raised as cattle. His associations with the rain and thunder became beneficial to the raising of crops and to the prosperity of humanity. Eventually he grew into what we now call Shiva, a god who retains his attributes as a wildly destructive force who is most often depicted with Shakti in the very act of creation (sex).
Rutbe—Female—Central America
Guaymian water goddess.
Sabazius—Male—Middle East/Mediterranean Wife: Bendis
Animal associations: Ram, Scorpion, Snake, Toad
Early Hebrew sun god and maybe ultimately the origin of the term Sabbat. However, this is probably just wild speculation on my part. Eventually he was associated and maybe absorbed by both Dionysus and Bacchus.
Sadhbh—Female—Central Europe
Irish goddess of deer who was herself transformed into a deer against her will.
Sakini—Female—Near East
Hindu goddess associated with the Vishuddhi chakra (throat). Sometimes described as an aspect of Shakti. See also Dakini, Rakini, Lakini, Kakini, and Hakini.
Sakkan—Male—Middle East/Mediterranean
Father: Samas
Animal associations: Bear, Lion, Cheetah, Wolf, Jackal, Hyena, Cattle (ox/wild), Gazelle, Boar, Wild Cat, Lynx, Beaver, Mongoose, Deer, Goat, Sheep, Leopard, Bear, Bobcat, Panther
Mesopotamian patron of animals. Depicted most often as a shepherd, he presides over animal fertility.
Salacia—Female—Mediterranean
Husband: Neptune
Animal associations: Dolphin, Fish, Shark, and all sea creatures.
Roman goddess of the oceans and of salt water.
Salmacis—Female—Mediterranean
Greek nymph who joined with the god Hermaphrodite to become the first bisexual being.
Salus—Female—Mediterranean
Roman goddess of health and well-being.
Samnati—Female—Near East
Husband: Dharma
Hindu goddess of humility.
Sampsa—Male—Northern Europe/Central Europe
(Also known as Sampsa Pellervoinen)
Finnish god who goes to sleep every Fall.
In so doing, he causes Winter. But when he wakes, he is reunited with his bride in Holy Matrimony, and Summer returns.
Sams—Female—Middle East
Semitic moon goddess.
Sancus—Male—Mediterranean
(Also known as Semo Sancus, Dius Fidus [divine faith])
Elder Roman god of good faith, oaths, and oral contracts. Patron and protector of those who act in good faith. But such oaths over which he presides must be made outside, in view of the sky.
Sanjna—Female—Near East
Husband: Surya
Animal associations: Horse
See Surya for her lore.
San-Ch’ing—Male—Central Asia
(Also known as San-qing)
Animal association: Frog
’Three pure ones’—The name given to the Taoist Triple God and to the heavens in which they rule. The first is Yuan-shi tian-zong who rules Yu-qing (the highest heaven). The second is Ling-bao tian-zong who rules Shang-qing (the middle heaven). The third is Tao-de tian-zong who rules Tai-qing (the lower heavens).
San-xing—Male—Central Asia
(Also known as San-hsing)
Three Chinese gods of good fate and fortune. They are Fu-xing (Luck/Health), Lu-xing (Honor/Status/Prosperity) and Shou-xing (Longevity/Wisdom). Perhaps the root of the expression early to bed and early to rise makes one ’healthy, wealthy, and wise.’
Sarama—Female—Near East
Indra’s faithful companion, a dog.
Sarasvati—Goddess—Near East
Animal associations: Peacock, Swan
Hindu goddess and protector of the river by her name.
Sati—Female—Near East
Husband: Shiva
Hindu avatar/incarnation of Parvati. When she was mistreated by her husband Shiva, she took her own life by throwing herself onto a sacrificial fire that had been lit in his praise.
Saturn—Male—Mediterranean
Wife: Ops
Son: Picus
Animal associations: Donkey, Crocodile, Goat, Vulture
Plant associations: Ash, Belladonna, Blackberry, Cypress, Fig, White Poppy, Hellebore (white), Yew
Roman god of harvest. With his wife Ops by his side, who is the goddess of plenty, he is king of the Saturnalia. This annual festival amounts to an entire week of feasting, revelry, and present giving. One of the key practices of the Saturnalia was the reversal of social roles. Masters became servants to their servants who became masters. Saturday receives its name from this god.
Satyr—Male—Mediterranean
Animal association: Goat
Greek Nature spirits of the wood and mountains. Their female counterparts are the nymphs. They are often depicted as having the upper torso, horned head, and arms of a man, but the bottom of a goat or other beast. However, they are sometimes shown in much more human-like form.
Scylla —Female—Mediterranean
Animal association: Dog
Greek sea nymph. The sea god Glaucus fell deeply in love with her, but she showed him little attention. So he went to Circe for a remedy, something to warm her heart to him. In talking to him, Circe fell deeply in love and became furious with Scylla either seeing her as competition or for the insult of not being attracted to Glaucus. Circe made a powerful potion and poured it into the pool where Scylla bathed. The moment Scylla stepped into that pool, she was changed into a hideous monster. So bitter is Scylla about the transformation, that to this day she devours and destroys any ship that passes her.
Sebek—Male—Africa
(Also known as Sobek)
Animal association: Alligator, Crocodile
Egyptian personification of the authority and power of the Pharaohs. He is depicted with the body and legs of a human but the head and upper torso of a crocodile or alligator.
Sedna—Female—Arctic North America
Animal associations: Seal, Fish, and all creatures of the sea.
Inuit Goddess of the Sea and of sea creatures.
Shaya—Female—Near East
Husband: Surya
Hindu handmaiden to Surya and sister to his wife Sanjna. See Surya.
Sheu—Female—North America
Husband: Kanati
’Corn’—Cherokee corn goddess. Often seen as a Crone goddess as well.
Seker—Male—Africa
(Also known as Sokar, Sokaris)
Animal association: Hawk
Egyptian hawk-headed god of plant fertility. He would later become associated with the Underworld.
Selene—Female—Mediterranean
Father: Hyperion
Mother: Theia
Lover: Endymion
Plant association: Willow
’Moon’—Greek goddess who fell so in love with the mortal Endymion that she begged Zeus to make him immortal, so she and her love could be together forever. Zeus granted her wish with the condition that Endymion would forever sleep. Selene accepted the condition and goes to her lover’s side every night just to watch him sleep. I believe this story tells of the love our Lady has for humanity. As we sleep, Selene (the Moon) watches over us all.
Sekhmet—Female—Africa
Husband: Ptah
Animal associations: Cat, Lion, Snake (cobra) Plant association: Pomegranate
Holiday: January 7th
Egyptian war goddess. Powerful and destructive, she was sent to Earth to put humanity in its place when it considered rising against the gods and achieving dominance over the world. She tells us that war and destruction are sometimes necessary tools against the rise of nations who wish dominance over the world.
Selkhet—Female—Africa
Animal association: Scorpion
Egyptian fertility goddess and protector of marriages. Associated with the Element Air and the protection of the god Kebechsenef.
Set—Male—Africa
(Also known as Seth, Setekh, Setesh, Seti) Animal associations: Dog, Donkey, Antelope, Hippopotamus, Boar (black), Crocodile, Scorpion, Goose, Turtle, Snake, Wolf, and to some degree all creatures of the desert.
Plant associations: Myrrh, Patchouli, Thistle
Set begins his journey through Egyptian lore as a minor deity of wind and storms. He ruled over confusion and the destruction that came with severe weather. Gradually, he gained favor and his name became widespread. So popular was he that eventually he fell into opposition with Osiris. Their story is no doubt another reflection on the relation between prosperity and war. Set is guardian of the dessert who protected the caravans which conducted trade with other nations. He was also a protector of Egypt and god of war. Osiris, on the other hand, is in part a fertility god.
Incense Recipe
2 part Patchouli
· 1 part Myrrh
· 1 part Gum Arabic
Enough Set or Patchouli oil to bind
Oil Recipe
· 11 drops Patchouli essential oil
9 drops Myrrh essential oil
1/2 ounce olive oil
Shai—Female—Africa
Egyptian Goddess of Fate. She followed the soul from birth, always watching over its shoulder, until death when she appeared at the souls judgment. Part of that judgment was if one fulfilled one’s destiny and lived in accordance with one’s true will. She is usually accompanied by her sister Renenet (Fortune). Sometimes Shai is seen as female and wife to Meshkent. Other times, the female version is cited as Shait and the male version as Shai. I prefer to think of her as Shai because I just can’t state with a straight face that my fate is Shait.
Shait—Female version of Shai
Shaitan—Male—Middle East
An order of Jinn (genie) in the pre-Islam tradition. Although all orders of Jinn could do good or evil, this particular order seems to have been adopted by Christianity as yet another example of the manifestation of the adversary to the Christian god.
Shakti—Female—Near East
Husband: Shiva
Hindu goddess associated with the active forces. Her husband Shiva is inactive except by her influence. Although she is typically cited as an incarnation/avatar of Shiva’s wife Parvati, she is more often depicted with Shiva. Interestingly enough, the most common goddesses to accompany Shiva in depiction seem to be Shakti (which whom he is shown as having sex with and thus creating) and Kali (under whom he sacrifices himself). So then, our Lord Shiva (Lord of Destruction) is most often depicted either creating or sacrificing. See also Dakini, Rakini, Lakini, Kakini, Sakini, and Hakini.
Shamash—Male—Mediterranean/Middle East (Also known as Sumerian Utu, Uta [Sumerian]) Father: Sinn
Mother: Ningal
Wife: Aya
Animal associations: Cattle (bull), Horse Note: Due to the merging of Sumerian and Babylonian pantheons, his mother and father are often cited differently.
Sumero-Babylonian sun god of the law and law abiding. Known as ’Chemosh’ in the Old Testament. Interestingly enough, he is sometimes seen as having Nergal as an aspect. Nergal is other times seen as a separate entity in opposition to Shamash. The implication is that good and evil are parts of the same whole. With the debunking of the anti-Pagan myth that Samhain was an evil Celtic god of the dead, Shamash became Samhain’s replacement as the deity of choice for the nuttier of the antiPagan movement to claim is worshipped at Samhain. At least this time they picked a deity name that actually exists.
Shango—Male—African/Caribbean/South America
In Santeria, his name is Chango
In Voodoo, his name is Shango/John the Conqueror
In Africa, his name is Shango
Saint and Catholic associations: Saint Barbara and St. Jerome
Father: Aganyu
Mother: Yemaja
Wife: Oya, Oshun
Holiday: Feast of Saint Barbara on December 4 Plant associations: Allspice, Apricot, Apple (blossom), Angelica, Anise, Asafoetida, Basil, Balm of Gilead, Bay, Bergamot, Calendula, Chamomile (common), Caraway, Clove, Carnation, Cedar, Cypress, Cumin, Dragon’s Blood, Deerstongue, Dill, Frankincense, Geranium, Ginger, Ginseng, Grains of Paradise, Galangal, Heather, Honeysuckle, Hyacinth (wild), Hyssop, Hibiscus, Juniper, Lilac, Lime, Lotus, Lavender, Mandrake (American), Mimosa, Mistletoe (American), Myrrh, Patchouli, Pennyroyal, Peppermint, Pine, Pepper (black), Rue, Sage (common), Sandalwood (white), Saffron (Mexican), Sesame, Thistle, Vanilla, Vervain, Violet
Yoruba Fire god of thunder and legendary first king of the Yoruba tribe. He was married to Oya and Oshun simultaneously. Do not confuse with the Central Asia Ch’ang-O.
Incense Recipe
4 parts Dragon’s Blood
2 parts Sandalwood (white)
1 part Cedar
1 part Cumin
Oil Recipe
8 drops Sandalwood oil
4 drops Clove oil
4 drops Cypress oil
4 drops Cedar oil
1/2 ounce Sesame oil as a base
Shasti—Female—Near East
Animal association: Cat
Hindu protector and patron of children.
Sheila Na Gig—Female—Central England
Irish fertility goddess who is depicted with her legs spread and her hands opening and exposing the inner folds of her vagina. Her image is used in both pre-Christian and Christian cultures to ward off evil as if to say, here is life.
Skeiron—Male—Mediterranean
Greek personification of the North East Wind.
Shen Mu—Female—Central Asia
Chinese Mother Goddess. Patron and protector of pregnant women, children, and the act of childbirth.
Shen Nung—Male—Central Asia
Wife: Shen Tsan
Chinese emperor who taught his people how to negotiate with Nature in the order of farming.
Shen Tsan—Female—Central Asia
Chinese wife of emperor Shen Nung who became a goddess associated with silk.
Sheu—Female—North America
Husband: Kanati
Cherokee corn goddess.
Shezmu—Male—Africa
Egyptian god of wine who played many roles, the most noted being the person who ripped the souls of evil people apart in the Underworld, forcing them to endure great suffering.
Shing Mu—Female—Central Asia
Chinese Mother goddess of intelligence. Patron and protector of prostitutes.
Shitateru-Hime—Female—Far East
Husband: Ame-No-Wakahiko
Japanese mortal woman who married the god Ame-No-Wakahiko.
Shiu Mu—Female—Central Asia
Holiday: February 1st
Chinese Mother and Water goddess.
Shiva—Male—Near East
Wife: Parvati
Note: Many of the wives cited to Shiva are aspects of Parvati. See Parvati and Shakti for more information.
Animal associations: Antelope, Cattle (bull), Elephant, Jackal, Snake (serpent),Tiger Plant associations: Dragon’s Blood, Geranium
Hindu god who forms the sacred triad with Vishnu and Brahma. He retook the heavens after they were taken in combat by Jalandhara. When Jalandhara tried to abduct Shiva’s wife Parvati it renewed his will to fight, causing him to rally the other gods to defeat Jalandhara. Although commonly thought of as a God of destruction, he is most often depicted either meditating or making love with wife Parvati in one of her many forms.
Incense Recipe
2 parts Dragon’s Blood resin
1 part Geranium flowers or Sandalwood powder dampened with geranium essential oil Enough Shiva or Dragon’s Blood perfume oil to bind
Oil Recipe
9 drops Dragon’s Blood perfume oil
6 drops Geranium essential oil
1/2 ounce base oil
Shou-Xing—Male—Central Asia
(Also known as Shou-Hsing)
Animal associations: Bat, Stag
’Star of longevity’—One of the three Chinese gods of good fortune, the San-Xing. He is the god of long life and wisdom.
Shou, Mo Li—Male—Central Asia
Animal association: Dragon
Mo Li Shou is the Chinese Buddhist guardian of the North. His statue is often included at the North point of Buddhist temples. In the modern practice of Feng Shui, his statue is placed in the North most part of a home to protect from negative influences coming from that direction. In Wiccan ritual, he is one of the names for the four Quarters, the other three being Hung, Chung, and Hai.
Shu—Male—African
Animal associations: Ostrich, Ram
Plant associations: Banyan, Damiana, Jasmine
Egyptian Air god who holds his daughter Nut above her brother and husband Geb. He was created by Ra and is often associated with the East/Air Quarter in Wiccan ritual. See also Ra, Tefnut, Seb, and Nut.
Incense Recipe
2 parts Jasmine
2 parts Gum Arabic
1 part Damiana
Enough Shu oil or Jasmine absolute to bind
Oil Recipe
12 drops Jasmine absolute
18 drops tincture of Damiana
6 drops tincture of Gum Arabic
1/2 ounce base oil
Sida—Male—Malaysia
(Also known as Sido)
Melanesian folk hero of Torres Island who taught his people both oral and written language. Later, he was viewed as a fertility god who created many useful plants and instructed humanity in the use of those plants.
Sif—Female—North Europe Husband: Thor
Scandinavian Earth Mother described as having beautiful golden hair. As a joke, Loki once snuck into her bed chambers and lopped off her hair. So furious was Thor that he put fear of death into Loki should he not return and repair the hair. Fearing for his life and realizing he had gone way too far in his trickery, Loki replaced the hair with magickly spun gold.
Sigmund—Male—North Europe
Wife: Hjordis
Scandinavian folk hero, loyal to Odin. After Odin plunged a sword into a tree, he declared the sword would belong to the man who had the might to draw it from the tree. Sigmund was that man and later won many victories with it. His last battle was with Odin who defeated Sigmund while in disguise by breaking the sword and wounding him severely. His wife Hjordis wanted to heal his wounds, but he declared that if his lord Odin desired him dead, then he must surely die. Upon his deathbed, he still valued the sword so much that he willed it to his unborn son, Sigurd, that he might continue the family tradition in service to Odin. Sigurd became the most noted of the Germanic heroes.
Silenus—Male—Mediterranean
Greek tutor and friend to Dionysus. Always drunk but also full of knowledge and able to divine the future. He presents the most unusual form of divination one can find. If you could knock him down and tie him up, forcing him to stop drinking long enough to sleep, he would dream of your future. If, however, you failed in your attempts, then your future would be filled with bruises from where he struck you repeatedly.
Silvanus—Male—Mediterranean
Animal associations: Woodpecker, Wolf, Sheep Plant associations: Juniper, Olive, Pine
Roman Horned God of the wild and guardian of boarders, particularly of the boarders between those areas between civilization and the wild.
Incense Recipe
4 part Pine needles (or 1 part pitch and 3 part Sandalwood)
4 parts Juniper berries
3 parts Gum Arabic
Enough Silvanus or Juniper essential oil to bind
Oil Recipe
9 drops Juniper essential oil
6 drops Pine essential oil
1/2 ounce Olive oil
Simbi—Male—Africa/Caribbean
(Also known as Sim’bi, Sim’bi d’l’eau)
Animal association: Snake
Haitian Voodoo deity of fresh water and friend to those who work magick.
Sin (1)—Male—North America
’Day’—Sky god of the Haida (North Pacific coastal area).
Sin (2)—Female—North Europe
Scandinavian goddess of truth.
Sin (3)—Male—Mediterranean/Middle East (Also known as Sinn, Sin-Nanna, Suen) Father: Enlil
Mother: Ninlil
Wife: Ningal
Animal associations: Cattle (bull), Dragon (lion)
Sumerian god of the moon and of measuring time. He gave wise council to the other gods who met with him at the end of each moon.
Sita—Female—Near East
Husband: Rama
Hindu goddess who was abducted and thought raped by Ravana. She escaped, killing Ravana, but did not at first reunite with Rama because it was thought that she had been raped by Ravana and was thus unclean. To demonstrate her virtue, she built a huge fire and walked into it. Rather than consuming her in its flames, the fire lifted her unharmed, proving her purity. She and Rama were thus reunited.
Skadi—Female—North Europe
Husband: Njord (first), Ull (second)
Scandinavian personification of Winter as the ’snow-shoe goddess.’
Sobek—See Sebek
Sol (1)—Male—Mediterranean
Roman god and personification of the sun.
Sol (2)—Female—North Europe (Also known as Sunna) Father: Mundilfari
Mother: Glaur
Husband: Glen
Scandinavian goddess and personification of the sun. Her brother is Mani, the Moon.
Soma—Male—Near East
Son: Budha by Tara
Animal association: Antelope
Plant association: Agaric Mushroom
Hindu moon god who fathered Budha by Tara after abducting and raping her. It is often mentioned that his name is shared by a plant and that the plant is associated with the drink of the gods, providing immortality and inspiration, a link between Heaven and Earth. But what most books don’t mention is why the above is so funny. You see, Soma is one of the folk names of the Agaric Mushroom (Amanita muscaria), which is commonly sold (illegally so) in the United States as ’magic mushrooms.’ One of the eight Hindu guardians of the principle directions. Soma is the guardian of the North East. The other seven are Indra, Agni, Yama, Surya, Varuna, Vayu, Kubera.
Sophia—Female—Middle East/Mediterranean (Also known as Hakhma, Chochma) Husband: Yahweh
Holiday: August 15th, October 5th
’Wisdom’—Hebrew, Greek and eventually Gnostic personification of Wisdom. Some cite her as wife of the Christian Yahweh. She is also said to be pictured in the famous painting at the Sistine Chapel in that capacity, her arm around Yahweh’s shoulder.
Spider Grandmother—Female—North America
Animal association: Spider
Common to several Native American tribes as trickster or messenger.
Spider Woman/Man—Female—Japan/North America
Animal association: Spider
Both Spider Man and Spider Woman are Navaho deities who instructed the Navaho in the art of weaving. Among the Pueblo of Mexico and Arizona, Spider Woman is found in much the same capacity. In Japan, Spider Woman seems to be a female incarnation of Inari.
Sradda—Female—Near East
Husband: Dharma
Hindu goddess whose name means ’Confidence.’
Ssu Ling—Male/Female—Central Asia (Also known as Ling)
The four creature guardians of Chinese mythology similar to the Wiccan four Quarters. They are Ch’i-lin, Feng-huang, Gui Xian, and Long.
Subhadra—Female—Near East
Hindu goddess and sister of Krishna.
Suitengu—Male—Far East
Japanese god of the sea who protects both sick children and sailors.
Summanus—Male—Mediterranean
Roman god of nighttime thunderstorms. Jupiter is the god of daytime thunderstorms.
Sun Hou Tzu—Male—Central Asia
(Also known as Sun Wu-kong, Sun Hou-zi) Animal association: Monkey/Ape
Chinese folk hero who became an immortal after his death and venture to the Underworld, where he found his name in the Book of the Dead and ripped its page from the book. He became god of the monkeys, which might be commentary on how the other gods felt about his defiance of that which was written. One of his other names, Wu-kong, is probably the source for the name on which the story of King Kong was based. The word wu loosely means ’king.’
Sura—Female—Near East
Plant association: Vine
Hindu goddess of grape and wine.
Surya—Male—Near East
Wife: Sanjna, Shaya
Animal association: Horse (mare)
Plant associations: Cinnamon, Frankincense, Sandalwood (white), Sunflower
Hindu sun god whose wife, Sanjna, left him because she could not stand his brilliance. In her place, Sanjna placed Shaya, hoping her husband would not notice. Surya did notice and fell in love with Shaya, but also reconciled with his wife by sacrificing an eighth of that which he was to bring her back. His story is why I have promised my love that when I finish this book, she will be more of a focus in my life. One of the eight Hindu guardians of the principle directions. Surya is the guardian of the South West. The other seven are Indra, Agni, Yama, Varuna, Vayu, Kubera, Soma.
Incense Recipe
4 parts Frankincense
2 parts Sandalwood
1 part Cinnamon
Enough Surya or Sandalwood essential oil to bind
Oil Recipe
9 drops Frankincense essential oil
6 drops Cinnamon essential oil
1/2 ounce Sunflower oil
Susanoo—Male—Far East
Son: O-Kuni-Nushi
Animal association: Snake
Japanese moon god who was banished from Heaven by his sister, the sun goddess Amaterasu.
Sus Sistinnako—Male—North American
Animal association: Spider
Sia Creator god who made mankind by strumming a spider’s web as an instrument and singing life into creation. Patron of musicians of string instruments and song.
Suwa—Female—Middle East
Arabic sun goddess. She is mentioned as an idol in the Koran. If a she had a central temple or icon, it was destroyed by Islam.
Svarog—Central Europe/Northern Europe (Also known as Svarozic, Svarozits) Animal association: Horse (white)
Slavic sun and Fire god. Initially seen as a supreme deity, he gradually became god of the metalsmith. He is responsible for formalizing the rites of marriage, declaring that the marriage under one culture or religion should be respected under all. In essence, he tells us that the unification of two people in such bonds transcends the structures of individual religions. Interestingly enough, after such a structure was established he gradually fell into the role of a fire demon.
Tailtiu—Female—Central Europe
Holiday: Lughnasadh
Irish patron of foster parents. She raised Lugh from infancy till the day he could bare arms. She was so loved by her foster child Lugh that he created the Tailteann games as a central part of the celebrations on Lughnasadh.
Takami-Musubi—Male—Far East
Wife: Amaterasu
Japanese Shinto Supreme Sky God and Creator who rules the world with his wife Amaterasu. With his wife, he is considered the greatest source of divine love.
Taliesin—Male—Central Europe
Plant association: Barley
Welsh son of Cerridwen who conceived him by eating a piece of grain that was really Gwion in disguise. He became a god of barley and most popular bard. Such was his fame that many historic bards have since taken his name. See Gwion for more of the story.
Tallai—Female—Middle East/Mediterranean
Canaanite goddess of rain. One of the aspects of the Canaanite’s Triple Goddess whose name means ’Maiden of Rain.’ See also Arsai and Pidrai.
Tammuz—Male—Middle East/Near East (Also known as Damuzi [Sumerian]) Father: Ea
Wife: Ishtar
Animal association: Boar
Plant associations: Pomegranate, Wheat, and all old world grains.
Akkadian Green Man. Here again we see the story of Persephone reversed in both gender and climate. Each year he travels to the Underworld as the hot summer approaches. His wife Ishtar mourns his loss and all fertility leaves the Earth. Eventually Ishtar negotiates his release (by trial and tribulation) and he returns as the year cools down, fertility returned to the Earth.
Tane—Male—Polynesian Islands
Father: Rangi
Mother: Papa
Wife: Hine-Ahu-One
Plant association: Kava Kava
Animal associations: Fish, Lizard, and to a degree all reptiles
Polynesian god of light and Creator who separated the primordial egg, divided it into Earth (his own mother Papa) and Sky (His own father Rangi). Interestingly enough, this is relatively the same story found in the creation and separation of the Yin and Yang told in the story of Pan-gu (Chinese)—right down to the egg.
Tangaroa—Male—Polynesian Islands (Also known as Ta’aroa, Tangaloa) Animal association: Fish, Lizard
Polynesian sea god. He is sometimes cited with similar attributes as his brother Tane, but those cites are probably due to confusion in the names. Tangaroa lives in the sea and needs to breath air only once a day. When his huge body surfaces to breath, the resulting water displacement causes the waves that lap the shore.
Tantalis—Male—Mediterranean
Greek king who made his son sacrifice to the gods. In response, Zeus restored the son to life and told Tantalis to go to Hades. There he was kept constantly hungry and constantly thirsty in the presence of the finest food and drink, chained in such a way that he could almost, but not quite, get to it. From his story we have the word tantalize. His story warns that those who harm children will be punished.
Taonoui—Female—Polynesian Islands
Lover: Roua
Son: Fati by Roua
Polynesian mother of the stars as viewed from Society Island.
Tara—Female—Near East
Husband: Brihaspati
Hindu star goddess who was kidnapped by Soma, raped, and released after Soma was forced to release her by Brahma but not before becoming pregnant with Budha.
Taranis—Male—Central Europe
Plant association: Holly, Oak
’Thunder’—Sky god of the Gaul. Roman records state clearly that he demanded and received human sacrifice. While this may be true, Roman records were given to disinformation about the folk they wished to defeat.
Tashmit—Female—Middle East/Mediterranean
Babylonian goddess of prayer and the written word. She and her husband Nebo invented the written language.
Ta Tanka—Male—North America
Animal association: Bison
’Great Beast’—Lakota word for Buffalo and sometimes a word used to describe the ’Great Spirit.’ However, the term Nagi Tanka is used by the Dakota and most often translated to ’Great Spirit’ or ’Great Mystery.’ I have little doubt that word tanka is being translated as ’Great,’ but I am not so sure the word tanka translates well into spirit. While the Buffalo were no doubt a great food source, I believe the idea that all Native Americans worshiped the ’Great Spirit’ as a buffalo god is a fabrication of the New Age movement.
Tatenen—Male—Africa
(Also known as Tathen, Tanen, Tenen, Ten) Animal association: Sheep
’Honored Earth’—Early Egyptian Earth God and Green Man image who represents the land that initially rose from the waters of the Earth. In essence, he can be seen as a Father Nature image.
Taukiyomi—Male—Far East Japanese moon god.
Ta-Urt—Goddess—Egypt (Also known as Taurt) Husband: Bes
Animal association: Hippopotamus
Egyptian goddess of good fortune and childbirth. With her husband, she is the protector of women during pregnancy, birth, and for a time after birth. She is also a protector of children. Her lore illustrates the early principle that childbirth led to good fortune, after all it was one’s children who provided the family work force. Her husband, Bes, is god of pleasure.
Tawhaki—Male—Polynesian Islands (Also known as Tawhiki)
Polynesian god of beneficial thunderstorms and good health.
Tawhiri—Male—Polynesian Islands
(Also known as Tawhiri-ma-tea, Tawhiri-Matea)
Father: Rangi
Mother: Papa
Polynesian god of the winds and baneful storms.
Tawiskara—See Ioskeha
Taygete—Female—Mediterranean
Father: Atlas
Mother: Aethra or Pleione
One of the Greek Pleiades. One of the many for whom Zeus lusted. Although she called on Artemis to hide her, Zeus discovered her hiding place. From that union she conceived Lacedaemon.
Tefnut—Female—Africa
Lover: Shu
Egyptian personification and goddess of Water and moisture. Her name is associated with the Wiccan Four Quarters. She is associated with Water and the West Quarter.
Tegid—Male—Central Europe
Lover: Cerridwen
Animal association: Boar (sow)
Plant association: Apple, Vervain, Willow
Welsh father of the ugliest boy (Avagdu) and most beautiful girl (Creirwy) in the history of the world.
Tekkeitsertok—Male—Arctic North America
Animal association: Deer
Eskimo Earth God who owned all the deer. He was given prayer and sacrifice in the order of fair exchange, prior to hunting deer. Without that exchange, the taking of deer was considered theft.
Tellumo—Male—Mediterranean
(Also known as Telluno)
Roman god of fertility. His female counterpart is Tellus Mater.
Tellus Mater—Female—Mediterranean
Animal association: Boar
’Earth Mother’—Roman Earth Mother and goddess of fertility. She is patron and protector of children and marriages. Her male counterpart is Telluno. The Sementivae honored her and Ceres.
Tempestes—Female—Mediterranean Roman goddess of storms.
Temu—Male—Africa
(Also known as Atum, Tum)
Animal association: Snake (serpent)
Early Egyptian creator and sun god. He evolved into a lesser role in the Egyptian pantheon, becoming associated with the setting sun rather than its entire cycle. Eventually he evolved into Atum- Ra. See Ra.
Tenazuchi-no-Kami—Female—Far East
Husband: Ashi-Nadzuchi
Japanese Earth Mother and goddess of fertility.
Terminus—Male—Mediterranean
Animal association: Sheep
Roman god of property, especially land. He defines boundaries and property lines.
Terpsichore—Female—Mediterranean Greek muse of poetry and dance. See also Muses, The.
Tethys—Female—Mediterranean
Husband: Oceanus
Greek personification and goddess of the ocean’s fertility. With her husband, Oceanus, she gave birth to the many fresh water bodies of water found on the Earth.
Tezcatlipoca—Male—Central America
(Also known as God of the Smoking Mirror)
Animal associations: Hummingbird, Jaguar, Panther
’Smoke Mirror’ or ’Smoking Mirror’—Aztec Sun God who is fond of music and ruled the dances of summer. At each of his festivals, a prisoner was made sacrifice to him, but only after that prisoner was treated as a king during his long festival, in which he received four wives who performed his every wish. That practice is immensely similar to European practices. His magick mirror resembles the scrying mirrors of today, except that smoke rises from it, and he uses it to reflect rays of sunlight to strike his enemy dead. He is patron to magicians and sorcerers.
Thalia—Female—Mediterranean
Father: Zeus
Mother: Euronyme
’Brings flowers’—One of the Three Graces found in Greek lore. Her parents are sometimes cited as Dionysus and Aphrodite. See also Euphrosyne and Aglaia. She is also the Muse of comedy. See also Muses, The.
Thanatos—Male—Mediterranean
Father: Hypnos
Greek god of death who lives in the Underworld.
Thaumas—Male—Mediterranean
Father: Pontus
Mother: Gaia
Wife: Electra
’Wonder’—Greek personification of the rainbow and messenger of the gods.
Theia—Female—Mediterranean
(Also known as Thea)
Lover: Hyperion
Greek goddess and mother to Helios (Sun), Selene (Moon), and Eos (Dawn).
Thetis—Female—Mediterranean
Animal association: Dolphin
Became the mother of Achilles after joining in the Great Rite with Peleus. Thetis reminds us that although we might do everything we can to protect our children, there will always remain a vulnerability.
Thor—Male—North Europe
(Also known as Donar)
Animal associations: Goat, Robin, Bear
Plant associations: Ash, Mountain Ash (Rowan), Birch, Common Daisy, Gorse, Hazelnut, Holly, Houseleek, Nettle (greater), Oak, Ox-eyed Daisy, Thistle, Vervain
Scandinavian god of the common man. He had many similarities to Odin except that Odin was more the god of the warrior class. Thor is the red-haired champion of the working class, requiring no sacrifice for his protection and guidance. His symbol is the hammer, which is most likely a phallic symbol.
Thoth—Male—Africa
(Also known as Djeheuty, Tehuti, Tahuti, Zehuti)
Wife: Nahmauit
Animal association: Ape, Jackal, Snake
Plant association: Almond, Beech, Benzoin, Birch, Gum Arabic, Vervain
Egyptian god of wisdom who is often seen as the scribe of his pantheon. He is said to have created the written language. He is patron of record-keepers and the divine mediator of the Egyptian pantheon.
Incense Recipe
2 parts Benzoin
1 part Vervain
Enough Thoth or Benzoin essential oil to bind
Oil Recipe
12 drops Benzoin essential oil
18 drops tincture of Vervain
6 drops tincture of Gum Arabic
1/2 ounce Almond oil
Three Marys, The—Female—Middle East/ Mediterranean
Christian Triple Goddess seen as either Mary Magdalene, the Virgin Mary, and Mary Cleopas or as the latter two with the former Mary Magdalene replaced by Mary Salome. As Mary Salome and Mary Cleopas were the sisters of the Virgin Mary, it does seem a better fit. Interestingly enough there is some lore stating that Mary Magdalene is an alternative name for Mary Salome that was created to protect the bloodline of Jesus. But don’t tell anyone, it is supposed to be a secret.
Three Mothers, The—Female—Middle East/ Mediterranean
Hebrew Triple Goddess associated with Air, Water, and Fire. Sometimes cited as having the names of the three mother letters in the Hebrew alphabet: Aleph, Mem, and Shin. Perhaps a precursor to the Three Marys of Christian lore.
Thunder Beings—Male—North America (Also known as Thunder Birds, Wakinyan) Animal associations: Eagle, Hawk, Moth, Woodpecker
Lakota and other Native American personification of thunder, lightning, and rain. Most often viewed as beneficial as they were responsible for providing the rain that nourished their crops. Sometimes seen as destructive in the way that most things in Nature are mostly beneficial but sometimes baneful.
Thunder Birds—See Thunder Beings
Tiamat—Female—Middle East/Mediterranean
Lover: Apsu
Animal associations: Cattle (bull), Dragon (snake), Snake (serpent and horned), Ostrich, and to some degree all birds
’Ocean’—Babylonian personification of the ocean as a huge dragon. Her lover is Apsu, who she separated from herself in a story similar to that of Diana and Lucifer. However, in the story of Tiamat, she is the personification of salt water who separates fresh water from herself. Here we see the Wiccan concept of salting unsalted water as a symbol of creation.
Tian-wang—Male—Far East/Central Asia (Also known as T’ien-wang)
Four Kings who guarded the Four Quarters in both Chinese and Japanese lore. Their images are still found in the temples of that area. Each is shown fully armored with a different skin color and holding different items in accordance with the direction they preside over. The King of the East has white skin. He is often shown with a lute which he uses to play music that brings tranquility and peace. The King of the South has blue skin. He is often shown holding a sword which he uses to fight back ignorance and darkness. The King of the West has red skin. He is often shown holding a snake. The King of the North has green skin. He is often shown holding a mongoose that spits jewels from his mouth in one hand and a parasol in the other.
Tiberinus—Male—Mediterranean
(Also known as Tiberis)
Animal association: Fish (especially fresh water)
Roman god of the River Tiber and patron of those who fish. Although his following was noted as being widespread among fishermen, little remains of his great lore.
Tiki (1)—Male—Polynesian Islands
Polynesian god and creator of land by causing it to rise from the ocean. He is a fertility god who is prayed to for conception. In his name, a charm of a phallus is worn around the neck of a woman who wishes to conceive. That charm was also called a tiki in his honor and praise. Although his name has become almost synonymous with wood deity images of the area, statuary of the phallus or of a male form with a large phallus are more appropriately attributed to Tiki.
Tiki (2)—Male—Polynesian Islands
The name of the first man created by either Tane or Ta Matauenga/Tu Matauenga.
Ti Mu—Female—Central Asia
Chinese Earth Mother.
Tisiphone—Female—Mediterranean
’Avenger of Murder’—Greek goddess of justice and vengeance. One of the three Erinyes. The other two are Alecto and Megaera.
Tlazolteotl—Female—Central America (Also known as Tlazolteotl Ixcuiname) Animal association: Snake (red)
Aztec Earth Mother and goddess of sex. She is a protector of children and of the mother at childbirth. She is also said to offer redemption at death. In that capacity she is called ’Eater of Filth’ because she is said to consume the confessed sins of a lifetime.
Toma—Female—Central Asia
Tibetan goddess associated with mind (human intellect).
Tonacatecuhtli—Male—Central America
Wife: Tonacacihuatl
’One at the center’—Aztec provider of bountiful harvests. The meaning behind his name notes that he is at the center of creation. When things are in balance, the Wheel spins properly around him and the harvest is plenty. When it is out of balance, the Wheel does not spin properly and there is a poor harvest. The Wheel in reference can be seen as the Wiccan Wheel of the Year. When Winter lasts too long, or when there is a late frost, plants die. Thus the Wheel is out of balance, and the harvest is poor.
Tonacacihuatl—Female—Central America Husband: Tonacatecuhtli
Female aspect/wife of Tonacatecuhtli.
Toruguenket—Male—South America
Brazilian moon god and personification of evil. In opposition to Torushompek, much the way the Christian Satan is in opposition to the Christian God.
Torushompek—Male—South America
Brazilian sun god and personification of good. In opposition to Toruguenket much the way the Christian God is in opposition to the Christian Satan.
Tros—Male—Mediterranean
(Also known as Troy)
Lover: Callirhoe
Greek culture hero for whom the city of Troy was named. He is the father of Ganymede by Callirhoe.
Tsai Shen—Male—Central Asia
Animal associations: Carp, Chicken (cock), Tiger
Chinese god of wealth and prosperity.
Tsukiyomi—Male—Far East
Father: Izanagi
Mother: Izanami
Japanese moon god and keeper of time.
Tsul Kalu—Male—North America
Cherokee god of hunting. Patron of hunters.
Tvashta—Male—Near East
(Also known as Tvashtar)
Father: Kashyapa
Mother: Aditi
Hindu craftsman responsible for crafting the thunderbolt of Indra and the moon cup which was used to serve ambrosia. He is one of the Adityas. The Hindu month Phalguna (February 20-March 21) is sacred to Tvashta. See Adityas.
Twen-Ch’ang—Male—Central Asia
Animal association: Crane
Chinese god of poetry and literature. Sometimes cited as female.
Tyndareus—Male—Mediterranean
Wife: Leda
King of Sparta. See Leda for a full account of their children.
Typhon—Male—Mediterranean
Wife: Echidna
Animal associations: Donkey, Scorpion, Snake Plant association: Cactus
Greek storm god. Born or created of Hera. He and his wife were so horrific that they even frightened the gods. It wasn’t until Zeus stood up to the two that the Earth found relief. With his example, the other gods and goddesses found the courage to join and finally defeated Typhon and his wife, but not until much of the Earth and Heaven was destroyed in the battle.
Tyr—Male—North Europe
Scandinavian god of law (especially common law) who became a god of war, demonstrating the principle requirement of war to enforce law. In the Scandinavian pantheon, he is one of the gods who favors the common man. Patron of athletes and law enforcement.
Ueueteotl—Male—Central America
Aztec god of fire in order of both creative/ useful and the destructive. A reminder that of the many forces in the universe which man believes he has mastered, fire will remain useful but forever unmastered.
Uga-Jin—Male—Far East
Animal association: Snake
Japanese serpent and Water god who brings fertility to the Earth. Like other serpent gods associated with water, he is seen in the rainbow.
Ukupanipo—Male—Polynesian Islands Animal association: Fish, Shark
Hawaiian shark god who determines the abundance of ocean harvests by driving fish either into the waiting nets of fishermen or away into the deep ocean.
Uller—Male—North Europe
Father: Thor (adopted)
Mother: Sif
Scandinavian sky god of hunting and skill at archery. Patron of hunters, especially bow hunters.
Uma—Female—Near East
Husband: Shiva
Hindu avatar/incarnation of Parvati. She is the personification of Light and the beauty that comes with an inner light and divine wisdom.
Umi Bozu—Male—Far East
Animal association: Octopus
Japanese sea monster who is said to be the sometimes baneful spirit of a monk who died at sea.
Ungud—Male/Female—Australia
Animal association: Snake
Aboriginal Australian hermaphrodite snake god. Although cited most often as a hermaphrodite, s/he sometimes takes on distinctly male form and other times s/he is distinctly female. In her female form, she is the Earth. In her male form, he is the rainbow that is still seen after the rain falls to the Earth.
Uni—Female—Mediterranean/Central Europe Animal association: Peacock
Etruscan supreme goddess who is associated with both Hera and Juno.
Unktomi—See Iktomi
Unkulukulu—Male—Africa
Animal associations: Chameleon, Lizard
Bantu Creator and educator of humanity.
Upulero—Male—Far East/Malaysia
Animal association: Chicken
Indonesian Sun God. Should a couple wish to conceive a child, the potential father calls on Upulero for his blessings and help in the matter, but only via sacrifice. Traditionally, that sacrifice took the form of a chicken. If you happen to live on a farm where the killing of chickens for food is routine, by all means do so, and then serve that animal’s flesh to someone in need as you and your family go without food for a day. If, however, you are not one of those who routinely kills animals for food, purchase an amount of non perishable food equal to that which would feed you family for a day, deliver that food to a shelter or pantry and then go hungry, with your wife, for the day in which the potential father calls on Upulero. Patron of couples who want to become parents.
Ura—See Uronica
Uranus—Male—Mediterranean
(Also known as Ouranos)
Father: Elium
Mother: Berus
Lover: Gaia
Animal association: Jay
Plant association: Ash
Greek sky god. Gaia formed him out of herself in much the same way Diana formed Lucifer, then set him about the sky and caused him to become her lover.
Urcaguary—Male—South American
Animal association: Snake (serpent with deer’s head)
Inca god of the richness of the Earth and of the treasures found beneath soil.
Uroica—Female—Central Europe (Also known as Ura)
Plant association: Heather
A Brenton goddess of Summer, heather, and heather wine. She is associated with the Feast of Brewing on September 28th, with the creation of heather wine and other alcoholic beverages for that feast.
Ushas—Female—Near East
Father: Dyaus
Mother: Prithvi
Ushas is the Hindu goddess of dawn. Most often cited as sister to Agni, she is sometimes cited as his wife. Her sister is Ratri (night).
Uta—See Shamash
Uther Pendragon—Male—Central Europe
Wife: Igraine
British king during the Saxon invasions of Britain, who asked Myrddin (Merlin) for assistance in his quest for the hand of Igraine. Myrddin granted him that request and transformed Uther into the image of Igraine’s husband, the Duke of Cornwall. During the night in which Uther, disguised as the Duke, and Igraine became initiated to each other, Arthur was conceived (later to become king). At the moment of Arthur’s conception, the real Duke of Cornwall was killed in battle against Uther’s troops. The story of the Duke of Cornwall and Arthur can be seen as founded in the roots of the ancient lore similar to the Oak and Holly King often used in Wiccan rituals to mark the Winter Solstice.
Utnapishtim—Male—Middle East/Mediterra-nean
(Also known as Ut-napishtim, Uta-Napishtim)
’He who saw life’—Sumero-Babylonian elder who was warned by Ea that the gods were concerned about humanity’s proliferation and had planned a Great Flood. To escape that flood, Utnapishtim built a great ship. After seven days of flood, he sent out a dove but that dove returned. He then sent swallow and it too returned. Finally he sent a raven which did not return, thus indicating there must have been land somewhere for the raven to have landed on. After finding dry land, he made sacrifice for his deliverance. So humbled were the gods in this mortal’s act of sacrifice even after witnessing the utter destruction of his world, that they felt great remorse for having killed so many with the flood, and they granted Utnapishtim immortality and promised never again to cause such an event. See Ishtar for more information.
Urania—Female—Mediterranean
Greek Muse of astronomy. See also Muses, The.
Utta—Female—Middle East/Mediterranean
Father: Enki
Mother: Ninkurra
Lover: Enki
Sumerian goddess whose lover, father, and great grandfather is Enki. See Enki for the story.
Uttu—Female—Middle East/Mediterranean
Sumerian goddess of vegetation and the use of vegetation by humanity. Also a name for the god Shamash.
Vach—Female—Near East
(Also known as Vac)
’Speech’—Hindu goddess of speech and of the process of experiencing the mysteries that normal speech cannot express. She is thus associated with the initiatory path of mystery religions such as Wicca.
Vadjra—Male—Far East
Japanese god of three faces. Those faces are the likely source for the statuary of three monkeys found in a 17th century Japanese temple. The best translation of the inscription on that statue is ’See no evil, hear no evil, and speak no evil’ or ’Mizaru, Kikazaru, Iwazaru.’ The statuary is most likely a representation of the three faces of a much earlier deity form, Vadjra. The fun part of this translation is that the Japanese word for monkey is ’saru,’ which is similar in sound to the ending of each of the three faces of Vadjra. It is likely that any association between monkeys and Vadjra is made only through the pun intended on the names of his three faces whose names are actually verbs with an ending that only sounds similar to monkey. In a modern context, this supports the Wiccan principle that like attracts like and the warning in the Wiccan Rede about spending time with fools. It is the commentary that upon seeing, hearing, or speaking evil, one risks becoming evil. Now that is not a steadfast rule, but an observation. Certainly statistics show that abused children tend to grow up to be abusive parents, but it is not always the case.
Vajra, Dakinis—Female—Central Asia
Dakinis Vajra is the Tibetan goddess associated with East, peace, love, and the divine. See also Ratna, Padma, Karma, and Buddha.
Vali (1)—Male—Northern Europe Father: Odin
Mother: Rind
Little is known about Vali other than he was born for the purpose of avenging Baldur’s death. He is sometimes cited as an excellent archer, but I am unclear if this is a modern creation to connect him with the Roman Vali (son of Juno), or if perhaps the Vali of Northern Europe and Mediterranean have a connection other than the name.
Vali (2)—Male—Mediterranean Mother: Juno
Vali is cited as an excellent archer and son of the goddess of love Juno Februa, making it a no-brainer that St. Valentine’s Day is probably built on his story.
Valkyries—Female—Northern Europe (Also known as Walkyries)
Animal associations: Horse, Eagle, Raven, Wolf, Swan
Plant association: Aspen
’Choosers of the slain’—The Valkyries are not only Odin’s messengers, they are the beings sent forth to select combatants for the final battle of Ragnarok. These beautiful young women comb the battlefields of man to witness how warriors fight and just as importantly, how they die. If they fight with the fierceness necessary for the final battle of the gods, the Valkyries take note. If they die without fear and having confidence that their cause was just, then they raise the slain warrior (called the Einherjar) and bring him to Valhalla where they train every day for the end days. Interestingly enough, that training involves being wounded and killed each day, then healed at night so they can participate in combat training the next day. Where other cultures consider such an afterlife to be unpleasant, the Norse folk considered it to be one of the highest honors a man could receive. Yet another example of cultural different views of the ever present lore of an afterlife.
Varaha—Male—Near East
Animal association: Boar
Plant associations: Nettle (greater and lesser), Oak
Hindu third avatar of Vishnu. When Hiranyaksha dragged the Earth beneath the ocean, Vishnu incarnated into this third avatar (a boar) to combat Hiranyaksha. After a thousand-year battle, Varaha was successful and restored the Earth to the surface.
Varahini—Female—Near East
Husband: Vishnu
Hindu Earth goddess and avatar/incarnation of Lakshmi.
Vamana—Male—Near East
Hindu fifth avatar of Vishnu who appeared in the form of a dwarf such that he could trick Bali (a demon) to give up the Earth. First he convinced Bali to give him a tiny plot of land only three paces in size. Bali agreed, and Vamana returned to the size of Vishnu. He then counted the first place as Earth, the second as Heaven, and the third he said Bali could keep. There Bali remains today, in the Underworld.
Varuna—Male—Near East
Father: Dyaus
Mother: Prithvi
Wife: Varuni
Animal associations: Cattle (cow), Horse (white), Snake
Hindu god of sky and Water who is the charge of law and order. He is the personification of the Moon and a god with a heart, dispensing justice only with mercy. One of the eight Hindu guardians of the principle directions. Varuna is the guardian of the West. The other seven are Indra, Agni, Yama, Surya, Vayu, Kubera, Soma. Varuna is also one of the Adityas. The Hindu month Bhardra (August 23-September 22) is sacred to Varuna. See Adityas.
Varuni—Female—Near East
Husband: Varuna
Animal association: Crow
Hindu goddess of liquor and intoxicating beverages and brews of all order.
Vaya—Male—Near East
Animal association: Deer
One of the eight Hindu guardians of the principle directions. Vayu is the guardian of the North West. The other seven are Indra, Agni, Yama, Surya, Varuna, Kubera, Soma.
Vediovis—Male—Mediterranean
(Also known as Vediovis)
Animal association: Goat
Elder Roman god of health and healing. He is often depicted with his trusted goat.
Vellamo—Female—Central Europe/North Europe
Husband: Ahto
Finnish goddess of the sea who, with the help of her husband Ahto, controls matters of underwater fertility.
Venus—Female—Mediterranean
Lover: Mercury
Animal associations: Heron, Cattle (bull), Dove, Lion, Lynx, Snake, Sparrow, Swallow, Swan, Turtle, Tortoise
Plant associations: Adam and Eve root, Anemone, Angelica, Apple, Apricot, Aster, Benzoin, Carnation, Cedar, Cinnamon, Clover (red), Daisy, Elder, Frankincense, Heather, Lily, Lime Tree, Mallow (blue, dwarf, musk), Maidenhair, Marjoram, Mistletoe (European), Myrtle, Orchid, Pine, Poppy, Quince, Rose, Sandalwood (red, white), Sunflower, Vervain, Violet
Roman goddess of Spring and Springtime love. She is the mother of Cupid by either Mercury (most often cited) or Mars. As deity, she started off as a goddess of vegetation fertility. Gradually she became goddess of the vine (grape) and the fermentation thereof until she eventually arrived as goddess of love. Isn’t that how it always happens? A little salad, a little wine, and all of a sudden there you are.
Incense Recipe
2 parts Sandalwood (white)
1 part Frankincense
1 part Benzoin
1 part Cinnamon
1 part Clove
Vertumnus—Male—Mediterranean
Roman god of gardens, orchards, and vineyards. One of the shape-shifters of Roman lore, probably acquiring that attribute from the change in appearance of plants as they grow and ripen.
Vesta—Female—Mediterranean
Animal associations: Donkey, Goat Plant associations: Adam and Eve Root, Dog Bane, Lucky Hand Root, Oak, Thistle
Roman goddess of fire and flame. December is her sacred month. In the home, she was goddess to the hearth and to the preparation of family meals. At ritual, she is the ritual fire itself. From her service, we receive the term ’Vestal Virgins,’ children chosen for service to Vesta who took a strict oath of celibacy for their 30 years of service. Roman records show that during the thousand or so years in which the Vestal Virgins served, only 20 broke their oath of celibacy. Unfortunately for them, the Roman records noting this are the accounts of their death as punishment for such actions.
Vica Pota—Female—Mediterranean
Roman goddess of victory. One of the older deity forms.
Victoria—Female—Mediterranean
Roman winged goddess and personification of Victory.
Vinar, The—Male/Female—North Europe
Scandinavian tribe of gods and goddesses of Nature and fertility who live in Vanaheimr. They were at one time the sworn enemies of the Aesir, but the two tribes were eventually united. The story of the conflict between the Vinar and the Aesir is told here in the Book of Exodus.
Virgin Mary—Female—Middle East/Mediter-ranean
(Also known as Bibi Miriam)
Plant associations: Hawthorn, Mountain Ash (Rowan)
Mother of Jesus in Christian lore. She is said to form a Triple Goddess with either Mary Magdalene and Mary Cleopas or with Mary Cleopas and Mary Salome (as opposed to Magdalene). Her worship migrated into Hindu lore where she is called Bibi Miriam and into both Voodoo and Santeria. During the last decade of the 20th century, the Pope and Vatican reaffirmed her divinity. Essentially, this was the confirmation that Catholicism sees divinity in part as female.
Vishnu—Male—Near East
Wife: Varahini
Animal associations: Ape, Eagle, Boar, Bee, Dolphin, Elephant, Fish, Horse, Lion, Peacock, Swallow, Turtle, Tortoise
Plant associations: Acacia, Amaranth, Banyon, Basil, Bay, Benzoin, Bodhi, Damiana, Frankincense, Ginseng, Gum Mastic, Jasmine, Mace, Mandrake, Marjoram, Nettle (greater and lesser), Oak, Palm (date), Sandalwood, Sunflower, Vervain, Vine (grape), White Poppy
Hindu sun god who forms the sacred triad with Brahma and Shiva. Vishnu has thus far had nine known avatars/incarnations: Matsya, Kurma, Varaha, Narasinha, Vamana, Parashurama, Chandra, Krishna, and Buddha. The foretold 10th avatar/incarnation is said to be Kalki who will come to be known only once the world has been greatly improved. Vishnu is one of the Adityas. The Hindu month Chaitra (March 22-April 20) is sacred to Vishnu. See Adityas.
Incense Recipe
6 parts Sandalwood (yellow)
3 parts Gum Arabic
3 parts Benzoin
3 parts Frankincense
1 part Jasmine flowers
1 part Bay
1 pinch Mandrake (optional)
Incense extra step: This recipe is wonderful as presented. But if you want to make the absolutely most heavenly incense you have ever burned, grind the above ingredients into a fine powder. It will be very sticky due to the large amounts of resin. Add this to a simmering pot of water along with a few dates or two and a few raisins. Simmer over low heat for an evening, adding water as necessary to keep it from boiling away. Then allow to cool and pour into a glass container. Set the mixture aside uncovered and allow it to evaporate until only dry solids remain. Depending on how much you are making and how much water you use, the drying process can take some time, but the results are worth it. Once it has dried, remove the solids and scrape the bowl of all the resins, grind into what will be a resin laden powder, allow to mellow for a couple of days, then burn over charcoal.
Oil Recipe
8 drops Sandalwood oil
3 drops Frankincense oil
3 drops Bay oil
3 drops Benzoin oil
3 drops Jasmine Absolute
1/2 ounce Sunflower (best) or Palm oil
Visvakarma—Male—Near East
Animal association: Horse
Hindu craftsman of the gods. Created the disc of Vishnu, the lance of Karttikeya, the trident of Shiva, and other magickal tools and weapons. Built the cities Lanka and Amaravati.
Vivasvana—Male—Near East
Father: Kashyapa
Mother: Aditi
Vivasvana is one of the Adityas. The Hindu month Jyaistha (May 22-June 21) is sacred to Vivasvana. See Adityas.
Vivienne—Female—Central Europe (Also known as Nimue)
Father: Dylan
Mother: Lady of the Lake
Lover: Myrddin (Merlin)
Her father is sometimes cited as Dynes, stemming from some of the mixed legends of King Arthur and the folk who filled his story.
Voles—Male—Central/Northern Europe (Also known as Veles)
Animal associations: Cattle, Horse, and to some degree all horned animals.
Slavic god and patron of cattle, horses, and horned animals. In the trade and production of those animals, he became a god of commerce and trade. Associated with fair exchange of value, he was said to bring prosperity only when both participants of a deal were honest. To demonstrate that honesty, deals were often sworn on his name.
Volcanus—Male—Mediterranean
(Also known as Vulcan)
Animal associations: Elephant, Lion
Plant associations: Aloe, Frankincense, Hibiscus, Nettle (greater), Red Poppy
Roman god of working metal and the fire that makes such works possible. The month of September is sacred to Volcanus.
Vulturnus—Male—Mediterranean
Roman personification and god of the East Wind. The other three are Aquilo, Auster, and Favonius.
Wekwek—Male—North America
Tuleyone falcon who stole fire from the sun and then set Earth on fire. This story is repeated in many tribes as an explanation of the western deserts of North America. The really fun part is when we see a very similar story in the Mediterranean. See Phaeton.
Wip—See Anubis
Xipe—Male—Central America
Aztec god of the first flowers of the year and to some degree all of the springtime foliage.
Yerah—Male—Middle East/Mediterranean
(Also known as Jarih)
Wife: Nikkal
Phoenician moon god.
Wadjet—Female—Africa
(Also known as Buto, Edjo, Udjo, Wadjit) Animal association: Snake
Snake goddess and protector of the Egyptian king.
Waels—See Waelsi
Wakinyan—See Thunder Being
Wepwawet—Male—Africa
(Also known as Upuaut, Wep-wawet, Ophois) Animal association: Wolf, Jackal
’Opener of ways’—Egyptian god of death and war. He has been depicted variously as having the body of a man but the head of either a jackal or a wolf. His name comes from his leading the way of soldiers into both combat and the afterlife.
Wishpoosh—Male—North America
Animal association: Beaver
A giant beaver who sinks canoes and causes men to drown.
Wyrd—Female—North Europe
Teutonic personification of Fate (for lack of a better word) as a Triple Goddess. Her three aspects included Urd (Past), Verdani (Present), and Skuld (future). See also the Book of Three, Part I for a better explanation.
Xochiquetzal—Female—South America Husband: Coxcoxtli
Animal association: Butterfly
’Flower feather’—Aztec moon goddess of flowers, love, and marriage. She was patron to all forms of the arts, especially of singing, dancing, and the creation of fabric.
Xolotl—Male—Central America
Animal association: Dog
Aztec god of lightning who guides departed souls to the Underworld (a place of rest). The only ones to escape this fate at death were women who died while giving birth and brave men who fell in battle. These folk receive a reward that is unspecified. Again, a clear connection to birth and death.
Yahweh—Male—Middle East
Also mistakenly known as Jehovah (see Jehovah) Wife: Aholibah, Ashera, Sophia
Plant association: Willow
Christian All Father who, with his wife Aholibah, was the parent of humanity. He had a falling out with his wife, left her, and then formed his own line of humanity, beginning with the creation of Adam and Lilith. Lilith was entirely too similar to his wife Aholibah, so he replaced her with Eve. Although Hebrew scripture leads us to see Aholibah as wife to Yahweh, there is also reference to the two wives of Yahweh from his Egyptian following in the 5th century b.c.e. As a bigamist, Yahweh’s wives are listed as Anatha Baetyl and Ashima Baetyl. Then there is the Canaanite reference to Ashera as wife and sister to Yahweh. So then the history of Yahweh is very similar to the history of many of the other gods. Additionally, the Goddess of Wisdom, Sophia, is depicted with Yahweh at the Sistine Chapel. Where Yahweh is reaching his hand out to touch humanity (Adam), Sophia’s arm is draped over Yahweh’s shoulder.
Yama—Male—Near East (Also known as Yamantaka) Wife: Pashadhari
Animal associations: Dove, Owl, Pigeon, Dog (watchdogs), Cattle (bull)
’The restrainer’—One of the eight Hindu guardians of the principle directions and the god of judgment at death. He decides who will and will not be reborn. Yama is the guardian of the South. The other seven are Indra, Agni, Surya, Varuna, Vayu, Kubera, Soma.
Yarhibol—Male—Middle East/Mediterranean
’Calf of the Lord’—Ancient Syrian (Pre Islam) moon god who forms a sacred triad with Bel and Aglibol.
Yasodhara—Female—Far East
Wife of the Buddha who was born spontaneously as the Buddha thought her into existence.
Yeggua—Female—African/Caribbean/South America
Saint association: Our Lady of the Forsaken Holiday: Feast of Our Lady of the Forsaken on October 30th
Orisha who lives among the tombstones of the graveyard. She is in charge of insuring that souls find Oya.
Yemaya—Female—African/Caribbean/South America
(Also known as Yemaja)
In Santeria, her name is Yemaya
In Voodoo, her name is Agwe/La Balianne
In Africa, her name is Yemonja/Yeyeomo eja Saint and Catholic associations: The Virgin Mary, Our Lady of Regla (Cuba)
Husband: Aganyu
Holiday: Feast of Our Lady of Regla on September 7th, December 31st (New Year’s Eve) Plant associations: Allspice, Angelica, Almond, Asafoetida, Balm of Gilead, Basil, Calamus, Coconut, Camphor, Cumin, Carnation, Citron, Daffodil, Eucalyptus, Gardenia, Grains of Paradise, Jasmine, Lemon, Lotus, Myrrh, Mugwort, Magnolia, Meadowsweet, Pennyroyal, Peony, Pine, Red Poppy (seed), Sandalwood (white), Valerian, Vetivert, Vine (grape), Watermelon
In Africa she is goddess of the ocean, and to a lesser degree, of fresh water ponds. She migrated into Voodoo and Santeria where she retains her association with the ocean and also becomes associated with the Virgin Mary.
Incense Recipe
4 parts Sandalwood (white)
3 parts Gum Arabic
1 part Myrrh
1 part Lemon peel
1 part Jasmine flowers
Oil Recipe
8 drops Sandalwood oil
6 drops Jasmine absolute
2 drops Lemon oil
· 1 drop Citron (optional)
1/2 ounce Almond oil as a base
Yhi—Female—Australia
Lover: Baiame
Son: Bahloo
Australian Aborigine sun goddess and All Mother who, with Bahloo, created all the animals of the Earth, including humanity. Although their relationship is occasionally recorded as incestuous, Yhi did not necessarily give birth to Bahloo. She created him as did she create Baiame, in much the way Diana created her lover Lucifer. With mixed lore, it is difficult to say which should be called son and which lover.
Yo—Male—Far East
Japanese principle of the masculine portion of the soul. Similar in ideology to the better known Chinese Yang. The Japanese Ying being In.
Yu—Male/Female—Central Asia
Animal association: Snake
Chinese hermaphrodite god who caused the world to be livable by slithering upon it. In so doing, she created the mountain passes and the valleys that hold rain long after the storm has stopped. S/he is also said to be the reason the Great Flood receded. Realizing it had caused the world to become unlivable, she guided the flood waters into the abyss.
Zephyrus—Male—Mediterranean
Father: Astraeus
Mother: Eos
Greek god of the West Wind associated with the West Quarter (Water) in Wiccan ritual.
Zeus—Male—Mediterranean
Father: Cronus
Mother: Rhea
Wife: Metis, Hera
Animal associations: Bee, Dove, Eagle, Goat, Swan, Woodpecker, Wolf, Cattle (bull), Sheep, Ram
Plant associations: Almond, Aloe, American Aspen, Apple, Common Aspen, Damiana, Fig, Hyssop, Jasmine, Myrrh (sweet), Oak, Olive, Parsley, Pine, Saffron (Spanish), Sage, Wheat
Listing the lovers of Zeus would be a book of its own. Certainly, he is a god of male virility especially when that virility is called upon to satisfy a younger lover. However, he is also a god who was not above forcing his desires on those he lusted after. Perhaps in his story we see the principle that power corrupts. With few that could stand up to him, he did seem to get his way a great number of times when he clearly should not have. Sometimes called the Father of the Gods, his lust for both goddesses and mortal women infuriated his wife Hera. Sometimes cited as his wife, other times as his consort, it is clear that Zeus felt they had an open relationship, while she felt Zeus was all hers. His list of lovers includes Aegina, Alcmena, Callisto, Calypso, Demeter, Electra, Leda, Leto, Maia, Semele, and many others. He is also cited as having a homosexual lover in Ganymede. As god chiefly responsible for land and mountains, he forms a sacred triad with his brothers Hades (Underworld) and Poseidon (the seas and oceans).
Incense Recipe
· 2 part Gum Arabic
1 part Jasmine flowers
1 part Hyssop
1 pinch Saffron (Spanish)
Enough Zeus or Galbanum essential oil to bind
Oil Recipe
9 drops Galbanum essential oil
6 drops Jasmine absolute
1/2 ounce base oil
Zocho—Male—Far East
Japanese god subordinate to Taishaku-ten who guarded the West. In Wiccan ritual he is sometimes connected with the West Quarter. The other three were Bishamon, Jikoku, and Komoku.
Chapter Commentary
Again, I have to remind you that this chapter is an overview of the many faces I see in our beloved Lord and Lady. There is a wealth of material available for your study. For that purpose, I strongly encourage you to visit the bibliography given at the end of this book. However, in so doing, remember that what is important is not how the ancients felt about these archetypes. Nor is what scholarly interpretation of what the ancients felt about these archetypes. What is important is what they say to you. Think of this process similar to the reading of Tarot. Yes, it is important that you read books that point out the symbolism on each card because the archetypes they represent are not nearly as clear as one might think. However, in understanding what those archetypes are and how to identify them, what is important in a Tarot reading is how the cards strike your mind and soul. It is these subtleties by which the reading of the Tarot reveals seemingly hidden information, and these subtleties will allow you to discover that same information within the many books that discuss our Lord and Lady.
Chapter Dedication
This chapter is dedicated to that school teacher mentioned in the Book of Holidays who had a mind so closed as to tell me the stories of the elder religions were not part of a valid religion. Not only were they a deeply integral part of the ancient religions, they are today a part of the fastest growing religion in the world.

A Final Word
Gay, Straight, Black, White
Same Struggle, Same Fight
Christian, Muslim, Pagan, Jew
There is just one world for me and you

uring the writing of this book, I have lost two of my dearest friends. As I close this book, my brother’s fiancee is in the hospital on bed rest. She is his first real love, and he is so worried about her. In the larger community, parents and families are now mourning the loss of the brave men and women in humanity’s latest temper tantrum. Watching the war in Iraq in all of its video-phone realism, I thought maybe the message of Wicca had come a bit
too late. Maybe humanity couldn’t come together and resolve its differences. Then I read something so profound that I could not let this book go to print without it.
CAOi
Where I am From
By Sharon Kay Carpenter
“I am from the defiant, free wheeling four-year-old riding her tricycle across a forbidden street, much to the dismay of Grandma Belle, and from the regretful, tear stained child with a stinging bottom.
I am from the boyish girl with a passion for climbing trees ever higher, to shout at the world, leaving my carved mark for anyone as brave as I to see, and from the safety of the earth where I returned.
I am from the mother cat and her three kittens hidden from the landlord in a closet, with my co-conspirator, Mom, helping block the view of our little guests, and ever increasing my love for her.
I am from Garfield Elementary School, ever drawing me back because I never wanted to leave, from McKinley Junior High School where children quickly learned social and class differences from the cruel remarks of older students and adults, and from Portsmouth High School where I couldn’t stay because financial necessity beckoned and Mom was no longer able to provide for the many needs in our lives.
I am from the 60s, from the era of the Beatles, from bell-bottoms, from drive in theaters, and from the King of Rock and Roll, Elvis.
I am from the country that heaped shame on soldiers returning from Viet Nam, from the spiritual country that prayed for every soldier through each war, and from the country that shed tears for a multitude not returning.
I am from the starry-eyed bride who married the love of her life, from a young mother of three, from the changed roles of my mother and me as I protected a child like adult from the suddenly overwhelming issues of aging, and from my new title, Grandma.
I am from memories of my past tricycle ride as my four-year-old grandson rides away on his new bike, from my continued love of animals, from my aches and pains of increasing age, and from climbing that tall tree as my granddaughter reaches up to me with her tiny hands.”
So who is Sharon Kay Carpenter? She is a 56-year-old widowed grandmother who has worked all of her life. She raised her children to be ’Good Christians’ and you know what? She succeeded, despite the fact that two of her children are Pagan (we might work on the third). She is a survivor of not only the death of a man she loved dearly, but of that which took my own father’s life, cancer. And after all that, she went back to college, where she wrote the essay presented here. One of her daughters, Aimee, tells me that their home was once filled with every order of animal, the wild ones spending just enough time to recover from injury or illness.
When Aimee was a teen, her mother accidentally hit a possum while driving to work. Without hesitation, she turned around to try and save the critter. She was beyond saving, but she had a pouch full of baby possums who desperately needed their mother. Sharon became that mother and bottle fed the children until they were weaned, always sure to withhold her abundant affection such that when they could leave her care they would have the best chances back in the care of Mother Nature.
Squirrels, possums, rabbits, a hawk, and a big fat raccoon that ate cat food on the front porch always had a home when it was needed. Not for her own amusement, but because she had no choice. Caring for critters is written in her soul. That is what I mean when I say a Wiccan soul. Oh, I don’t care if she is Wiccan, Christian, Muslim, Jewish, or any other religion because no matter what church a person attends, what is really important are the things we do between religious services.
I care because she passed part of her soul on to her children, and I have fallen head over heels in love with one of them. Sorry, Bubba, it isn’t you. I care because I want to spend the rest of my life with one of her daughters (despite the fact that she once thought all cats were girls and all dogs were boys) and because I cannot imagine having a more Wiccan mother-in-law, despite the fact that she is not Wiccan.
Mrs. Carpenter, I care because I very much want your blessing when I ask your daughter Aimee to be my wife. If after reading this, you can find it in your heart to give us your blessings, then upon Aimee’s consent; I will be honored to be your son-in-law.
Blessed be and live free,
A.J. Drew
I try to be as interactive as an author can be. If you would like to discuss this or any of my books, please visit www.PaganNation.com and become involved in our effort to form a responsible and responsive Pagan Community.

Endnotes
Liber ab Genesis
1. A prayer was recorded by Ahmed ibn Fadlan in 922 c.e.and attributed to the “Norsemen” of south east Russia (near the Volga River) of the time. I cite Albert Stanburrough Cook’s “Ibn Fadlan’s Account of Scandinavian Merchants on the Volga in 922,” Journal of English and Germanic Philosophy, vol. 22 (1923), pages 54-63.
2. I have not been able to confirm or deny this, but I believe the quote “Our creator as evidenced by our creativity” was originally the motto of the creator of the Dazzle Screen saver. Unfortunately, I think that was back in the days of DOS X when a 286 was hot property. I am afraid I cannot confirm its origin.
Liber ab Tres 1
· 1. The American Heritage Dictionary of the English Language, Fourth Edition. Houghton Mifflin Company, 2000.
· 2. From the story of the great flood as presented by the Gilgamesh Epic which appears in countless books. I cite here the version I copied as a teenager, but do not know the exact origin of these exact words.
· 3. A variation on the Serenity Prayer, originally written by Reinhold Nieburhr.
Liber ab Exodus
General:
The story of Ash and Elm and indeed all of Genesis should be considered a construct to explain evolution and the accumulation of humanity’s basic knowledge of his or her world. At position one (1) on the map that accompanies this chapter, humanity probably numbered about 10,000 and not two as is implied in The Book of Genesis. The principles set forth in this chapter are based on the modern science and study of mitochondrial DNA. This is a relatively new science. I first became aware of this science and the new Out of Africa theory by watching a show on the Discovery Channel. See bibliography for specifics.
Specific:
1. As cited by the Associated Press, November 9, 2002.
2. From the story of the Great Flood as presented by the Gilgamesh Epic that appears in countless books. I cite here the version I copied as a teenager, but I do not know the exact origin of these exact words.
Liber ab Quattuor
· 1. Generally attributed to Aleister Crowley. This quote has appeared in several of his works.
Liber ab Tres11
· 1. The American Heritage Dictionary of the English Language, Fourth Edition. Houghton Mifflin Company, 2000.
Liber ab Planta
· 1. Presented here is a greatly condensed version of the manuscript originally written as Liber ab Planta. It was originally written as both a spiritual and encyclopedic look at the first order of plants in much the same way Liber ab Clementia appears. Unfortunately, due to space considerations the publisher could not include it in its entirety. As a result, the complete Liber ab Planta is now an ongoing and expanding work, which might at a later date find its way into publication.
· 2. A quote from notes that I took at a presentation by Tatia Kingslady. She spoke at a good pace, so I might have missed a word or two as I was recording what she said with a pen and paper.
· 3. http://news.bbc.co.uk/1/hi/sci/tech/411639.stm—published Thursday, August 5, 1999.
Liber ab Sol
1. Although the Wiccan Rede’s author is often cited as Lady Gwen Thompson, she did not claim to have written it. She simply submitted it for publication under the title Rede of the Wiccae, stating that it was given to her by her grandmother, Adriana Porter. Looking back on those early days of the movement, we see there was a great deal of material provided by grandmothers and never credited to the original author.
2. Cited from “The Origins of Imbolg” by Tatia Kingslady. Published by Poison Pen as part of the Imbolg 1974 installment of The Wheel.
Liber ab Familia
· 1. Presented here is a condensed version of Liber ab Familia. The original manuscript included an expanded and encyclopedic look at our critter friends. Unfortunately, the editor felt it was far too long to be presented here. It is now an ongoing work, which I hope to one day offer for publication.
· 2. From The American Heritage Dictionary of the English Language, Fourth Edition, Houghton Mifflin Company, 2000.
· 3. Some cite the Neolithic Revolution as taking place 10,000 b.c.e., but the majority of cites place it at between 6,500 and 7,000 b.c.e., or 8,500 to 9,000 years ago. As the revolution was a process and not a single event, it is hard to pinpoint an exact date.
Liber ab Mentis
1. The American Heritage Dictionary of the English Language, Fourth Edition, Houghton Mifflin Company, 2000.
Liber ab Mortuus
1. The first line from the first letter written by Damien Echols to A.J. Drew.

Bibliography
Adkins, Lesley & Roy. Handbook to Life in Ancient Greece. New York: Oxford University Press, 1997.
Andrews, Ted. Animal-Speak. St. Paul, Minn.: Llewellyn Publications, 1993.
Angell, Madeline. America’s Best Loved Wild Animals. New York: Bobbs-Merrill, 1975.
Arnott, Kathleen. African Myths and Legends. New York: Oxford University Press, 1989.
Baierlein, Ralph. Thermal Physics. Cambridge: Cambridge University Press, 1999.
Bandinelli, R.B. Rome: The Center of Power 500 B.C. to A.D. 200. New York: George
Braziller, 1970.
Barthell, E.E. Gods and Goddesses of Ancient Greece. Coral Gables, Fla.: University of Miami Press, 1971.
Bickerman, E.J. Chronology of the Ancient World. Ithaca, N.Y.: Cornell University Press, 1982.
Bickerman, E.J. Chronology of the Ancient World. Southhampton, N.Y.: Camelot Press, 1980.
Blamires, Steve. Celtic Tree Mysteries. St. Paul, Minn.: Llewellyn Publications, 2002.
Blanchard-Lemee, M. Mosaics of Romans Africa. New York: George Braziller, 1996.
Bocking, Brian. A Popular Dictionary of Shinto. United Kingdom: Curzon Press, 1996.
Bonnefoy, Yves. American, African, and Old European Mythologies. Chicago: University of Chicago Press, 1993.
Bullock, M. Daily Life in Ancient Egypt. New York: McGraw Hill, 1964.
Burkert, Walter. Greek Religion. Cambridge: Harvard University Press, 1985.
Caesar, Julius. The Cival War. The Cival War. Rome, 46 b.c.e.*
Caesar, Julius. The Conquest of Gaul. Rome, 50 b.c.e.*
Chase, Pamela. Trees for Healing. New Castle, 1991.
Cicero. Political Speeches. Rome, 44 c.e.*
Cicero. The Nature of the Gods. Rome, 45 c.e.*
Cook, B.F. Greek and Roman Art in the British Museum. London: British Museum Publications, 1976.
Cooper, J.J., ed. Brewer’s Book of Myth and Legend. Oxford: Helicon Publishing, 1993.
Cotterell, Arthur. Dictionary of World Mythology. Oxford: Oxford University Press, 1979.
Crowley, Aleister. 777. New York: Weiser, 1973.
Cunningham, Scott. The Complete Book of Incense, Oils, and Brews. St Paul, Minn.: Llewellyn Publications, 1989.
———. Cunningham’s Encyclopedia of Magical Herbs. St. Paul, Minn.: Llewellyn Publications, 1985.
———. Magical Aromatherapy. St. Paul, Minn.: Llewellyn Publications, 2002.
Dallapiccola, Anna. Dictionary of Hindu Lore and Legend. London: Thames & Hudson, 2002.
Danielou, Alain. The Myths and Gods of India. Rochester, Vt.: Inner Traditions, 1991
Davidson, Hilda. Scandinavian Mythology. New York: Peter Bedrick Books, 1986.
———. The Road to Hel. Westport, Conn.: Greenwood Publishing Group, 1968.
———. Myths and Symbols in Pagan Europe: Early Scandinavian and Celtic Religions. Syracuse, N.Y.: Syracuse University Press, 1989.
———. The Viking Road to Byzantium. Lanham, Md.: Rowman & Littlefield, 1976.
———. The Battle God of the Vikings: The First G. N. Garmonsway Memorial Lecture Delivered 29 October 1971 in the University of York. University of York, Centre for Medieval Studies, 1972.
———. The Lost Beliefs of Northern Europe. London; New York: Routledge, 1993.
Davis, F. Hadland. Myths and Legends of Japan. New York: Dover, 1992.
Deiss, J.J. Herculaneum. New York: Harper and Row, 1985.
Del Chiaro, M.A. Roman Art in West Coast Collections. New York: St. Martin’s Press, 1973.
Dimmitt, Cornelia, ed. Classic Hindu Mythology. Philadelphia: Temple University Press, 1978.
Dimont, Max I. Jews, God and History. New York: New American Library, Times Mirror, 1962.
Discovery Communications, Inc. The Real Eve. Discovery Communications, 2002. Compact disc.
Dorig, J. Onatas of Aegina. Leiden, Netherlands: E.J. Brill, 1977.
Ellis, Peter. Celtic Myths and Legends. New York: Carroll & Graf, 2002.
———. A Brief History of the Druids. New York: Carroll & Graf, 2002
Euripides. The Heracleidae. Athens, 425 b.c.e.*
Fagles, Robert, trans. The Odyssey. New York: Penguin Group, 1999.
Farrar, Janet and Stewart. The Witches’ God. Washington: Phoenix, 1989.
———. The Witches’ Goddess. Washington: Phoenix, 1987.
Fast, Howard. The Jews, Story of a People. New York: Bantam, Doubleday, Dell Publishing, 1992.
Ferguson, J. The Religions of the Roman Empire. Ithaca, N.Y.: Cornell University Press, 1970.
Finnegan, Ruth. Oral Literature in Africa. Oxford: Oxford University Press, 1976.
Forman, W. The Romans: Their Gods and their Beliefs. London: Orbis Publishing, 1984.
Fowler, W.W. The Religious Experience of the Roman People. London: MacMillan, 1911.
Frazer, James. The Golden Bough. New York: Collier Books, 1922.
Gardner, J.F. Roman Myths. London: British Museum Press, 1993.
Gibbon, E. The Decline and Fall of the Roman Empire. New York: Knopf Publishing, 1993.
Gikatilla, Rabbi Joseph. Gates of Light (Sha’are Orah). San Francisco: Harper Collins Publishers, 1994.
Glare, P.E.,, ed. Oxford Latin Dictionary. Oxford: Oxford University Press, 1983.
Glassman, Sallie. Vodou Visions: An Encounter with Divine Mystery. New York: Random House;Villard Books, 2000
Gonzalez-Wippler, M. Powers of the Orishas. New York: Original Publications, 1992.
Graves, Robert. The Greek Myths. New York: George Brazillier, Inc., 1955.
———. The White Goddess. New York: Farrar, Straus and Giroux, 1948.
Guerber, H.A. Myths of the Norsemen. New York: Dover, 1992.
Holme, B. Bullfinch’s Mythology. New York: Viking Press, 1979.
Hope, Murry. Practical Egyptian Magic. New York: St. Martin’s Press, 1984.
Hopman, Ellen Evert. Tree Medicine Tree Magic. Washington: Phoenix, 1991.
Hurbon, Laennec. Voodoo: Search for the Spirit. New York: Harry N Abrams, 1995
Ions, Veronica. Indian Mythology. New York: Peter Bedrick Books, 1983.
Johnson, Sylvia. The Wildlife Atlas. Minneapolis: Lerner Publishing, 1977.
Jung, Carl. Man and His Symbols. New York: Anchor Press, 1964.
Karade, Baba Ifa. Handbook of Yoruba Religious Concepts. New York: Weiser, 1994.
———. Ojise: Messenger of the Yoruba Tradition. New York: Weiser, 1996.
———. Imoye: A Definition of the Ifa Tradition. New York: Athelia Henrietta Press, 1999.
Knappert, Jan. Pacific Mythology. London: Harper Collins 1992.
———. The Encyclopedia of Middle Eastern Mythology & Religion. Shaftesbury: Element Books, 1993.
Kovacs, Maureen. The Epic of Gilgamesh. Stanford University Press, 1989.
Leach, Maria, ed. Funk & Wagnalls Standard Dictionary of Folklore, Mythology, and legend. New York: Harper Collins, 1984.
Leland, Charles G. Aradia: Gospel of the Witches. New York: Buckland Museum, 1968.
Littleton, C. Scott . Shinto: Origins, Rituals, Festivals, Spirits, Sacred Places. Oxford: Oxford University Press, 2002.
Lyttleton, M. The Romans: Their Gods and their Beliefs. London: Orbis Publishing, 1984.
McElheny, Victor. Watson and DNA: Making a Scientific Revolution. Perseus Publishing, 2003.
McLaughlin, Marie. Myths and Legends of the Sioux. Lincoln, Nebr.: University of Nebraska Press, 1990.
Michels, A.K. The Calendar of the Roman Republic. New Jersey: Princeton University Press, 1967.
Mikalson, J.D. The Sacred and Civil Calendar of the Athenian Year. Princeton University Press, 1975.
Miller, Richard. The Magical and Ritual Use of Aphrodisiacs. Rochester, Vt: Destiny Books, 1993.
———. The Magical and Ritual Use of Herbs. Vermont, Destiny Books, 1993.
———. The Magical and Ritual Use of Perfumes. Vermont, Destiny Books, 1993.
Montenegro, Carlos. Magical Herbal Baths of Santeria. New York: Original Publications, 1996.
Muryn, Mary. Water Magic. New York: Fireside, 1995.
Nicholson, Irene. Mexican and Central American Mythology. New York: Peter Bedrick Books, 1982.
O’Hara, Gwydion. The Magick of Aromatherapy. St. Paul, Minn.: Llewellyn Publications, 1998.
Palmer, Jessica Dawn. Animal Wisdom. London: Thorsons, 2001.
Pantel, Pauline. Religion in the Ancient Greek City. Cambridge: Cambridge University Press, 1992.
Parke, HW. Festivals of the Athenians. Ithaca, N.Y.: Cornell University Press, 1994.
Patai, Raphael. On Jewish Folklore. Detroit: Wayne State University Press, 1983.
Pliny the Elder. Natural History, 10 vols. Harvard University Press, 1992.
Poinsias, Mac Cana. Celtic Mythology. New York: Peter Bedrick, 1983.
Reed, Ellen Cannon. The Heart of Wicca. York Beach, Maine: Samuel Weiser, 2000.
Richter, G. Engraved Gems of the Romans. New York: Phaidon Press, 1971.
Salzman, M.R. On Roman Time: The Codex-Calendar of 354 and the Rhythms of
Urban Life in Late Antiquity. Berkeley: University of California Press, 1990.
Sameh, W. Daily Life in Ancient Egypt. New York: McGraw Hill, 1964.
Saxo, Grammaticus. The History of the Danes Books I-IX. Cambridge: DS Brewer, 1998.
Scholem, Gershom. Major Trends in Jewish Mysticism. New York: Schocken Books, 1972.
Seneca. Hercules. Rome, 50 c.e. *
Shafer, B. Religion in Ancient Egypt. Ithaca, N.Y.: Cornell University Press, 1991.
Smith, Steven. Wylundt’s Book of Incense. Maine, Samuel Weiser, 1989.
Speak, Graham, ed. Encyclopedia of Greece and Hellenic Traditions. Independence, Ky: Fitzroy Dearborn Publications, 2000.
Spence, Lewis. Myths of the North American Indians. New York: Dover, 1992.
Spretnak, Charlene. Lost Goddesses of Early Greece. Boston: Beacon Press, 1992.
Strouhal, E. Life of the Ancient Egyptians. London: Opus Publishing, 1992.
Sympson, Jacquelyn. European Mythology. New York: Peter Bedrick, 1987.
Tacitus, C. The Annals of Imperial Rome. Rome, 120 c.e.*
Tacitus, C. The Agricola. Rome, 98 C.E.*
Tarostar. The Witch’s Formulary and Spellbook. New York: Original Publications, 1996.
Taube, Karl. Aztec and Maya Myths. Austin: University of Texas Press, 1994.
———. The Gods and Symbols of Ancient Mexico and the Maya. London: Thames & Hudson, 1993.
———. The Major Gods of Ancient Yucatan. Washington, D.C.: Dumbarton Oaks Publishing Service, 1992.
Thorsson, Edred. Witchdom of the True. Smithville, Tex.: Runa Raven Press, 1999.
Waters, Mary. Black Identities. Harvard University Press, 2001
Weinstein, Marion. Positive Magic. Franklin Lakes, N.J.: New Page Books, 2002.
Wolkstein, D. Inanna Queen of Heaven and Earth. New York: Harper & Row, 1983.
York, M. The Roman Festival Calendar of Numa Popillius. New York: Peter Lang, 1986.
Zaidman, Louis. Religion in the Ancient Greek City. Cambridge Press, 1992.
Zerubavel, E. The Seven Day Circle. New York: The Free Press, 1985.
* A collection of photocopies of unknown English translations routinely reproduced at the Ohio State University with no cite to origin, translator, publisher, or date.